KEGG   Komagataella phaffii: PAS_chr1-1_0411
Entry
PAS_chr1-1_0411   CDS       T01092                                 

Definition
(RefSeq) C-14 sterol reductase, acts in ergosterol biosynthesis
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ppa  Komagataella phaffii
Pathway
ppa00100  Steroid biosynthesis
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
Module
ppa_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PAS_chr1-1_0411
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PAS_chr1-1_0411
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 DUF2273
Other DBs
NCBI-GeneID: 8196541
NCBI-ProteinID: XP_002490069
UniProt: C4QX15
Position
1:1325160..1326479
AA seq 439 aa
MVPLNEITAHKDFLGVPGAISISLGLPIVVVLLYLLSNPDYVVDGFYIDFGKVIEVCNKH
FVEEFYSTFANSTCWKIYLGWFGGLICLDLVLPGKLLKGVILRDGTQLKYHINGLPMAGL
LASILVARWFQTNGSMPELQFLYNNILNFSIVTIEFSFILATACYLFSFIPLRRPNGVNT
RSRILAVGGNTKNPIFDWFIGRELNPRIGSWDIKLFCELRPGMLLWLLINLSCLHQQYLK
EGKIFDSLLLVNFLQMFYIIDGVLNEEGLLTMMDIATDGFGFMLAFGDLTLVPFTYSLQS
RYLVLKPVHLGLFNMILICILAFTGYYIFHSANSQKSKFRQGLLPSMKSIETETGSKLLV
DGWWRRSQHINYLGDWLIAWSWCLPTGFNSVLPYYYVIYFGVLLVHRQTRDEDKCQRKYG
KYWTMYQKEVPYKIIPYVY
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggttcctctcaacgaaatcactgcacacaaagacttcctcggagtaccaggagcaata
tccatatcgctaggcctgccaattgttgttgttctactatatctgcttagcaatccagat
tatgtagtggatggattctacatagactttggtaaggtgatcgaggtctgtaacaagcat
ttcgtagaagaattttattcaacttttgcaaactccacctgttggaaaatttacttgggt
tggtttggtggtttaatatgtttagatttggtcctgccagggaaactgttgaaaggtgta
atattaagagatggaactcagttgaagtaccatatcaacggcctacctatggccggcctt
ctagcctccattttagtggcaaggtggtttcaaactaatggatcaatgcctgagctacaa
tttctttacaacaacatcctcaacttttccattgtgacaatcgagttttcatttatctta
gcaacagcttgctatctattttcgttcattcctttaaggagaccaaatggagtcaataca
aggtcaaggatccttgcggttggaggcaacactaaaaacccaatttttgactggtttatt
ggtagggaattgaacccaagaataggatcttgggatattaaacttttctgcgaactaagg
cctggaatgttactttggttgctgattaacttgtcatgtttgcaccaacagtatttgaag
gaaggaaaaatattcgactctcttttgttagttaacttcttacagatgttctatataatt
gatggagtgttgaatgaagaaggtcttttaactatgatggacatagccacagacggattc
ggatttatgttggcttttggtgatcttactttggtcccctttacttattcactgcagtct
cgatatttggttttgaagccagtccatttagggttattcaatatgatcctgatatgtatc
cttgctttcacaggctattatatttttcattcagctaatagtcaaaagtcgaagtttcgt
caaggcttacttccatccatgaaatcaattgaaaccgaaactgggtctaaactgctagta
gacggttggtggaggcgttctcagcatatcaactatctaggagactggttaatcgcatgg
agttggtgtctaccgacagggtttaactcagttctgccatactattatgtgatatatttt
ggggtattgttggtccatagacaaactagagacgaggataaatgtcaacgaaagtatggc
aagtattggacgatgtaccaaaaagaagtaccttacaaaattataccttatgtgtactaa

DBGET integrated database retrieval system