KEGG   Komagataella phaffii: PAS_chr1-3_0094Help
Entry
PAS_chr1-3_0094   CDS       T01092                                 

Definition
(RefSeq) Dihydrolipoyl transsuccinylase, component of the mitochondrial alpha-ketoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppa  Komagataella phaffii
Pathway
ppa00020  Citrate cycle (TCA cycle)
ppa00310  Lysine degradation
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
ppa01130  Biosynthesis of antibiotics
ppa01200  Carbon metabolism
Module
ppa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAS_chr1-3_0094
  Amino acid metabolism
   00310 Lysine degradation
    PAS_chr1-3_0094
Enzymes [BR:ppa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PAS_chr1-3_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N HlyD_D23
Motif
Other DBs
NCBI-GeneID: 8196826
NCBI-ProteinID: XP_002489434
UniProt: C4QV80
Position
1:complement(177343..178668)
Genome map
AA seq 441 aa AA seqDB search
MFSKSARLVKQVKVSLPVTPMASRRFLQTAPKFMGAASIRNPRLIAPRSLQLIRFQSQTV
KVPDMAESITEGTLSQFLKKVGDYVAADEVVATIETDKIDVEVNSPVAGTITELLAAEED
TVEVGQDLFKVEPGAKPEGAAAAPKAEEPGEKKTEEAAPASSTEKKEEPPAAAWAPPPKT
AEPAAPAKKETPKQTKEETSAPKAGTFSRNEERIKMNRMRLRIAERLKESQDTNASLTTF
NEVDMTSLMEMRKLYKDEFLEKTGIKFGFMGAFSRASALAAKDIPSVNAAIENNDTIVYR
DYMDISIAVATPKGLVTPVVRNVESLSVLDIEKEISNLGKKARDGKLTLEDMAGGTFTIS
NGGVFGSLYGTPIINIPQTAVLGLHGVKQRPVVVAGGKIEARPMMYLALTYDHRMMDGRE
GVIFLKTIKELIEDPRKMLLM
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttttctaaatcagctcgcttagtcaagcaggttaaggtgtccttaccagtgacccca
atggcctctagaagattccttcaaactgcacccaaatttatgggcgctgcttctatccgc
aacccacgtctcattgcccccaggtctcttcagttgattagatttcaatcacaaactgtg
aaagttccagatatggccgagtctattacagagggaaccctgtcacagttcttaaagaaa
gtaggtgattatgtggctgccgatgaggtggttgctaccatcgaaacggataagatcgat
gttgaggtcaattccccagtggctggtaccataactgaacttttagctgccgaggaagat
accgtcgaggttggacaggatctgttcaaggttgaacctggtgccaaacctgaaggtgcc
gccgcagccccaaaagctgaagagcctggtgagaagaagactgaagaggcagccccagct
tcatctacggaaaagaaggaggaaccccctgccgcagcttgggcccctcccccaaaaact
gctgaaccagcagctccagcaaaaaaggaaactccaaaacagactaaggaggagacttct
gccccaaaagctggcactttctcaagaaatgaagagcgaattaaaatgaaccgtatgaga
ctacgtattgcagagagactaaaggaatctcaagacactaacgcttccttgactactttt
aacgaggtggacatgacctccttaatggaaatgcgtaagttgtacaaggatgaatttttg
gagaagactggcattaaattcggattcatgggtgccttttcccgtgcttccgcccttgcc
gccaaggacattccatctgttaacgctgcaattgaaaacaatgataccattgtctaccgt
gattacatggacatttccattgccgtggctactccaaagggacttgttacgccggtggta
cgtaacgtcgaatctttatctgttttggatatagagaaagagatctccaatttgggtaag
aaagctagagatggtaagttaactctagaggacatggccggtggaacctttacaatctcc
aacggaggtgtatttggctcgttatacggaacaccaatcatcaatattcctcagactgct
gttctgggtctacacggagttaaacagaggccagttgttgttgccggaggtaagattgag
gcccgtccaatgatgtaccttgctttgacttacgatcaccgtatgatggatggtagagag
ggtgttattttcctcaagacgatcaaggagctcattgaagatccacgcaagatgttgctc
atgtaa

DBGET integrated database retrieval system