KEGG   Komagataella phaffii: PAS_chr1-3_0264Help
Entry
PAS_chr1-3_0264   CDS       T01092                                 

Definition
(RefSeq) Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin)
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
ppa  Komagataella phaffii
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAS_chr1-3_0264
Enzymes [BR:ppa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     PAS_chr1-3_0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 8196495
NCBI-ProteinID: XP_002489608
UniProt: C4QVQ4
Position
1:483173..483670
Genome map
AA seq 165 aa AA seqDB search
MELTALRSSNPNTMIDQPLGRIVFELYDDVPKTIENFRALCTGEKGYGYKDSIFHRVIPQ
FMLQGGDFTKFNGTGGKSIYGEKFADENFIHKHTKPGLLSMANAGPNTNGSQFFITTVPC
PWLDGKHVVFGEVVDGLDVVSKIETLGSSSGATKTQLKITNSGEL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggaattaaccgcattgcgcagcagcaaccctaacaccatgatagaccaaccattgggc
cgtattgtcttcgagttatacgatgatgttccaaagaccattgagaacttcagagctctg
tgtactggagagaagggttacgggtacaaagactccatttttcacagagtcatccctcaa
ttcatgttgcaaggtggtgatttcaccaagttcaacggaactggtggcaaatcaatctat
ggtgagaagttcgctgacgagaacttcatccacaagcacaccaagccaggtttgctgtca
atggctaacgccggtccaaacaccaatggttcccaatttttcattaccactgttccatgt
ccttggttagatggtaagcacgttgtatttggtgaggtcgtcgacgggctggacgttgtc
tccaagatcgagaccttgggatcatcttctggtgctaccaagacccagttgaagatcacc
aactccggtgagttgtaa

DBGET integrated database retrieval system