KEGG   Komagataella phaffii: PAS_chr2-1_0256Help
Entry
PAS_chr2-1_0256   CDS       T01092                                 

Definition
(RefSeq) Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to prote
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ppa  Komagataella phaffii
Pathway
ppa00514  Other types of O-glycan biosynthesis
ppa00515  Mannose type O-glycan biosynthesis
ppa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    PAS_chr2-1_0256
   00514 Other types of O-glycan biosynthesis
    PAS_chr2-1_0256
Enzymes [BR:ppa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     PAS_chr2-1_0256
Glycosyltransferases [BR:ppa01003]
 O-Glycan biosynthesis
  O-linked Man type
   PAS_chr2-1_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_4TMC MIR PMT_2 DUF2723 T4SS_CagC
Motif
Other DBs
NCBI-GeneID: 8198805
NCBI-ProteinID: XP_002491148
UniProt: C4R044
Position
2:480498..482750
Genome map
AA seq 750 aa AA seqDB search
MTGRVDQKSDQKVKELIEKIDSESTSRVFQEEPVTSILTRYEPYVAPIIFTLLSFFTRMY
KIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNGSWDFPSGQE
YPDYIDYVKMRLFNATFSALCVPFAYFTMKEIGFDIKTTWLFTLMVLCETSYCTLGKFIL
LDSMLLLFTVTTVFTFVRFHNENSKPGNSFSRKWWKWLLLTGISIGLTCSVKMVGLFVTV
LVGIYTVVDLWNKFGDQSISRKKYAAHWLARFIGLIAIPIGVFLLSFRIHFEILSNSGTG
DANMSSLFQANLRGSSVGGGPRDVTTLNSKVTIKSQGLGSGLLHSHVQTYPQGSSQQQIT
TYSHKDANNDWVFQLTREDSRNAFKEAHYVVDGMSVRLVHSNTGRNLHTHQVAAPVSSSE
WEVSCYGNETIGDPKDNWIVEIVDQYGDEDKLRLHPLTSSFRLKSATLGCYLGTSGASLP
QWGFRQGEVVCYKNPFRRDKRTWWNIEDHNNPDLPNPPENFVLPRTHFLKDFVQLNLAMM
ATNNALVPDPDKEDNLASSAWEWPTLHVGIRLCGWGDDNVKYFLIGSPATTWTSSVGIVV
FLFLLLIYLIKWQRQYVIFPSVQTPLESADTKTVALFDKSDSFNVFLMGGLYPLLGWGLH
FAPFVIMSRVTYVHHYLPALYFAMIVFCYLVSLLDKKLGHPALGLLIYVALYSLVIGTFI
WLSPVVFGMDGPNRNYSYLNLLPSWRVSDP
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgacaggccgtgtcgaccagaaatctgatcagaaggtgaaggaattgatcgaaaagatc
gactccgaatccacttccagagtttttcaggaagaaccagtcacttcgatcttgacacgt
tacgaaccctatgtcgccccaattatattcacgttgttgtcctttttcactcgtatgtac
aaaattgggatcaacaaccacgtcgtttgggatgaagctcacttcggaaagtttggctcc
tactatctcagacacgagttctaccacgatgtccaccctccgttgggtaagatgttggtc
ggtctatctggctacattgccggttacaatggctcctgggatttcccctccggtcaagag
taccctgactatattgattacgttaaaatgaggttattcaatgccaccttcagtgcctta
tgtgtgccattcgcctatttcaccatgaaggagattggatttgatatcaagacaacttgg
ctattcacactgatggtcttgtgtgaaacaagttattgtacgttaggaaaattcatcttg
ctggattcaatgctgctgctattcactgtgactacggttttcacctttgttaggttccat
aacgaaaacagtaaaccaggaaactcgttttctcgcaaatggtggaaatggcttctgctt
actggtatttccattggtctcacttgttccgtcaaaatggtgggtttatttgtcacagta
ttagttggaatttacacagttgttgacttatggaataaatttggtgatcaatccatttct
cgtaagaaatatgctgctcattggctagctcgtttcatcggcttgattgccatcccaatt
ggcgtttttctattgtcattccgtatccattttgaaatattatccaattctggtaccggt
gatgcaaacatgtcttcattgttccaagctaaccttcgtggatcatccgtcggaggaggc
cccagagatgtgaccactctcaactctaaagtgaccataaagagccaaggtttaggatct
ggtctgttacattcccacgttcaaacttatcctcaaggttccagccaacaacagattaca
acctattctcacaaagatgccaacaatgattgggtgtttcaacttacgagagaagactct
cgaaacgctttcaaggaagcccactatgtcgttgatggtatgtctgttcgtctcgttcat
tcaaacactggtagaaacttacacactcaccaagttgctgctcccgtctcctcatccgaa
tgggaagtcagttgttatggtaatgaaaccattggagacccgaaagataattggattgtt
gaaattgtcgaccagtatggtgatgaagataagctgagattgcacccattgacctccagt
ttccgtttgaaatcggcaactctgggatgctatttgggtacttcgggtgcttcactgcct
caatggggtttcagacaaggtgaagttgtttgttacaaaaatccgttccgtagagataag
cgcacctggtggaacatcgaggaccataacaatcctgatctacctaatcctccagaaaat
tttgttcttcccaggactcattttttgaaagactttgttcaattaaatttagcaatgatg
gcaacaaacaacgctttggtcccagacccagataaggaagataatctagcttcttctgcc
tgggaatggcccacgctacacgttggtatccgtctgtgcggttggggcgatgacaacgtc
aagtatttcttgattggttctcccgcaaccacctggacttcttcagttggtattgtagta
ttcctgttcctgctgttaatttacttgatcaaatggcaacgtcaatatgtcattttccca
tccgtccagactccactagagtcagccgacaccaaaacagttgcattgtttgacaagtct
gatagcttcaacgtcttccttatgggaggattatacccgcttctgggatggggtttacat
tttgctccgtttgtgatcatgtcgcgtgttacctacgttcaccattatcttcctgcattg
tactttgccatgattgttttctgctacttggtttctctgttggataagaaactaggccac
ccagcattaggattactgatctatgtggctctgtattccttggtcattggaacatttatt
tggctcagccccgttgtgtttggtatggacggtccgaacagaaattacagttacctaaac
cttctacctagttggagagtatcagacccatag

DBGET integrated database retrieval system