KEGG   Komagataella phaffii: PAS_chr2-1_0472Help
Entry
PAS_chr2-1_0472   CDS       T01092                                 

Definition
(RefSeq) Mitochondrial alcohol dehydrogenase isozyme III
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppa  Komagataella phaffii
Pathway
ppa00010  Glycolysis / Gluconeogenesis
ppa00071  Fatty acid degradation
ppa00350  Tyrosine metabolism
ppa01100  Metabolic pathways
ppa01110  Biosynthesis of secondary metabolites
ppa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAS_chr2-1_0472
  Lipid metabolism
   00071 Fatty acid degradation
    PAS_chr2-1_0472
  Amino acid metabolism
   00350 Tyrosine metabolism
    PAS_chr2-1_0472
Enzymes [BR:ppa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PAS_chr2-1_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 8198395
NCBI-ProteinID: XP_002491382
UniProt: C4R0S8
Structure
PDB: 

Position
2:875193..876245
Genome map
AA seq 350 aa AA seqDB search
MSPTIPTTQKAVIFETNGGPLEYKDIPVPKPKSNELLINVKYSGVCHTDLHAWKGDWPLD
NKLPLVGGHEGAGVVVAYGENVTGWEIGDYAGIKWLNGSCLNCEYCIQGAESSCAKADLS
GFTHDGSFQQYATADATQAARIPKEADLAEVAPILCAGITVYKALKTADLRIGQWVAISG
AGGGLGSLAVQYAKALGLRVLGIDGGADKGEFVKSLGAEVFVDFTKTKDVVAEVQKLTNG
GPHGVINVSVSPHAINQSVQYVRTLGKVVLVGLPSGAVVNSDVFWHVLKSIEIKGSYVGN
REDSAEAIDLFTRGLVKAPIKIIGLSELAKVYEQMEAGAIIGRYVVDTSK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaactatcccaactacacaaaaggctgttatcttcgagaccaacggcggtccc
ctagagtacaaggacattccagtcccaaagccaaagtcaaacgaacttttgatcaacgtt
aagtactccggtgtctgtcacactgatttgcacgcctggaagggtgactggccattggac
aacaagcttcctttggttggtggtcacgaaggtgctggtgtcgttgtcgcttacggtgag
aacgtcactggatgggagatcggtgactacgctggtatcaaatggttgaacggttcttgt
ttgaactgtgagtactgtatccaaggtgctgaatccagttgtgccaaggctgacctgtct
ggtttcacccacgacggatctttccagcagtatgctactgctgatgccacccaagccgcc
agaattccaaaggaggctgacttggctgaagttgccccaattctgtgtgctggtatcacc
gtttacaaggctcttaagaccgctgacttgcgtattggccaatgggttgccatttctggt
gctggtggaggactgggttctcttgccgttcaatacgccaaggctctgggtttgagagtt
ttgggtattgatggtggtgccgacaagggtgaatttgtcaagtccttgggtgctgaggtc
ttcgtcgacttcactaagactaaggacgtcgttgctgaagtccaaaagctcaccaacggt
ggtccacacggtgttattaacgtctccgtttccccacatgctatcaaccaatctgtccaa
tacgttagaactttgggtaaggttgttttggttggtctgccatctggtgccgttgtcaac
tctgacgttttctggcacgttctgaagtccatcgagatcaagggatcttacgttggaaac
agagaggacagtgccgaggccatcgacttgttcaccagaggtttggtcaaggctcctatc
aagattatcggtctgtctgaacttgctaaggtctacgaacagatggaggctggtgccatc
atcggtagatacgttgtggacacttccaaataa

DBGET integrated database retrieval system