KEGG   Komagataella phaffii: PAS_chr2-1_0777Help
Entry
PAS_chr2-1_0777   CDS       T01092                                 

Definition
(RefSeq) Mitochondrial tRNA pseudouridine synthase involved in pseudouridylation of mitochondrial tRNAs
  KO
K15453  tRNA pseudouridine31 synthase [EC:5.4.99.42]
Organism
ppa  Komagataella phaffii
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ppa03016]
    PAS_chr2-1_0777
Enzymes [BR:ppa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.42  tRNA pseudouridine31 synthase
     PAS_chr2-1_0777
Transfer RNA biogenesis [BR:ppa03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    PAS_chr2-1_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 zf-ribbon_3
Motif
Other DBs
NCBI-GeneID: 8198957
NCBI-ProteinID: XP_002491713
UniProt: C4R1Q9
Position
2:complement(1484112..1485188)
Genome map
AA seq 358 aa AA seqDB search
MEMRYTINANLRQCNPYFYTHVFHVKGRWIGMTVLDVFCNEFKSRSEEYYRLNIDNGTIK
LIRNRGLATEQTIDKSLLYSTLIKSGDCVVNTEHKHEPEVGIGEEIVYQDDNILVVNKPC
GVPVHPTGKYYYNTMTEIMKNELGVSSLYPCHRLDRLTSGILIIGKTPRAAAKYQTQLKQ
NSIQKTYIARVDGEFPMGNIVCSDKIVNIDCKRGKENGITEPKEALTNFQRLAYSTSLNQ
SIVKCSPKTGRTHQIRIHLRNLGHPIANDPLYGFNELLGIRRESPCGTLSEKSFEQVVKL
ATKKRDESRSANTCPKCGINLYRQRNPEELGIWLHALSYRSIDWKFHTRYPPWAKLQV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagatgagatatacgataaatgctaacttgaggcaatgcaatccgtatttttatacc
catgtattccatgttaaagggagatggattggcatgacagttttggacgttttttgcaat
gagttcaaatcaaggagtgaggagtattatagattaaacattgacaatggaacaataaaa
ctcatacgcaataggggcctcgcaacagagcaaacaatagacaaaagtcttttgtatagt
actcttattaaaagtggtgactgcgtagtgaatacagaacacaaacatgaacctgaggtt
ggtatcggggaagagattgtctaccaggatgataatattttggttgtgaacaagccatgc
ggtgttcctgtacatcctacgggcaagtattattacaacactatgacagaaattatgaaa
aatgaattgggtgtatcgtcactttacccgtgtcatcgattggacagattgacttcaggt
attttgattattggaaagacaccccgtgccgcagcaaagtatcaaacccagttgaaacag
aactccatacaaaaaacatacattgctcgtgtagatggtgaattcccgatgggcaatatc
gtttgttcggataaaattgttaacatagattgtaaaaggggaaaagaaaacggaattaca
gaaccaaaagaagcacttactaatttccaacggctcgcatatagtactagcttaaatcaa
agtatagtaaaatgcagcccgaaaacaggtcggactcaccagattcggatccatctcaga
aacctgggccatcccatagcaaatgatccactgtatggtttcaacgagttgcttggtata
agaagagaatcaccgtgtggaacgctaagtgaaaagtcatttgaacaagttgttaaatta
gcaacaaagaaaagagatgaatcaaggtctgcaaatacttgcccaaaatgcggaatcaac
ttgtacaggcaaaggaatccagaagagttgggaatatggctgcacgcgcttagttatcgg
tcaattgactggaagtttcatactcggtatcctccttgggctaaactgcaggtttga

DBGET integrated database retrieval system