KEGG   Komagataella phaffii: PAS_chr3_0282Help
Entry
PAS_chr3_0282     CDS       T01092                                 

Definition
(RefSeq) Plasma membrane transporter for both urea and polyamines
Organism
ppa  Komagataella phaffii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSF
Motif
Other DBs
NCBI-GeneID: 8200206
NCBI-ProteinID: XP_002492501
UniProt: C4R436
Position
3:complement(555949..557973)
Genome map
AA seq 674 aa AA seqDB search
MTEFILTQGFGYGIALGLGAAFALLMMATTYTAKKFLGQKQDSERFTTASRSVKQGLISS
CVVSSWTWPGTLLTSSQWAYQYGVVGSYWYAAMGSFQVLLFTLVAIEIKKRCPGIHTIAE
VARVRFGRGGHLVYLSYCLGTNVIVSCMLLLGGSQGFSFSTGMHIVAACFLLPMGVCVYT
LFGGLQATFLSDWTHTVIIYVIILVCLTTVYGTSDLIGSPGKMYDLLTEIAKESPSSAAN
GSYLTFDNRAMIFTAWNLLMGGASTVFGDPSYSQKAIAASAKDVMFGYITGGLCWQIIPW
GLGTCTGLAALALTNNPASYTYPNALTVEEAEKGLPLVYGMAAIFGKSGAAAAVVMIFMS
VTSAMSAELISCSSILTYDFYRSYVNPKASGKQLVTASHIFVIAFSIFMGGLAVVFNYIG
VTIGWILNFIGIALGPVLGALLGMLFYPKMTKHAMWFGPTMATLTGVACWLGSCHHFYGE
LNKDNLAGNYPSAIGNFVSVFTSPLYIFLISLIKPQSFDLSTLNDQFEAGDDAEETELER
MKVQETDLDQLNKSLIQTRIFLIIHASIFVFILPLSLYGSGYIFSKRFFTAWVVITIIWE
YLAAMWIIIWPLYESRVTLRYVIMKLLGKEGHLYYGAGEVKEISTSDQSFATPSVAEAKN
EHHVNVITDSDHDM
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattcatactgactcaaggttttggttacgggatagccctaggtttgggtgct
gcttttgccctgttaatgatggcaactacttacactgctaagaaatttctgggacagaaa
caagactcagaaaggtttaccactgcttcgagatctgtaaagcagggtttgattagtagt
tgtgttgtcagtagttggacttggcctggtactctgctgacttcctctcagtgggcatac
cagtatggtgtggtcggctcatactggtatgcagctatgggatcttttcaagtcttactg
ttcactttggtggctattgagataaagaagaggtgccctggtattcatacaattgctgaa
gttgccagagttagatttggtagaggtggccacttggtctatctatcctactgtctgggt
actaatgtgatcgtgagctgcatgctcttgctgggaggctctcaaggattctccttttcc
accggcatgcatatcgttgcggcatgcttcctattacctatgggagtgtgtgtctatacg
ttgtttggtggtttgcaagcaacattcctgtctgattggactcacaccgtgatcatttat
gtcattatcctagtctgtttgactacagtctacggtacttctgatttgattggatcacca
ggaaagatgtacgatcttttgaccgaaattgctaaagagagcccatcatctgctgcaaat
ggatcatacctgacatttgataatagggctatgattttcactgcttggaacttgttgatg
ggaggtgccagtacagtttttggagatccttcatactcccaaaaagctattgcggcttct
gcgaaagatgtcatgtttggctacattaccgggggactctgctggcaaataattccttgg
ggattgggaacttgtactggtttggctgccctggctctcactaacaacccagcttcatac
acttatcctaatgcgttaactgtagaggaggccgaaaagggactgccgttggtctatgga
atggctgctatctttgggaaaagcggagctgcagctgctgtcgttatgatttttatgtct
gtcacatcagccatgtctgcagaacttatttcttgttcttccattttaacctatgacttt
taccgatcctatgtcaatccaaaagcttccggaaagcaattggtgactgcatcccacata
tttgttattgctttctctatttttatgggaggtttagctgtggtattcaactacatagga
gttacgatcggatggattttgaactttattggtattgctttaggtcctgtccttggagct
ttacttggaatgcttttctacccaaagatgacaaaacatgccatgtggttcggtccaacc
atggcgacgctcacaggtgttgcttgttggttgggatcttgccatcatttctacggcgag
ctaaacaaagataatttggctggaaactatccttccgccattggtaactttgtgtctgtc
tttacctcaccattgtatattttcctgatttctttgataaagccgcaatctttcgattta
tctacgttgaatgatcagtttgaggcaggtgacgatgctgaggagactgagctagagagg
atgaaagtgcaagagactgacctcgatcaattgaacaaatcattgatccagaccagaatc
tttttgattattcatgcttcgatttttgtctttatcttacctctgtcgctgtacggttca
ggctacattttctctaaacgatttttcaccgcttgggttgttatcaccatcatttgggaa
tatttagctgccatgtggatcattatctggccattatatgagagtcgtgttacgctacgg
tacgttattatgaaactcctaggaaaagaaggccatctttactacggggcaggagaagtt
aaagaaatcagtacaagcgaccaatcgtttgcaacgccctcagtggctgaagcaaagaac
gagcaccacgtaaacgtgatcactgacagtgaccatgatatgtag

DBGET integrated database retrieval system