KEGG   Komagataella phaffii: PAS_chr3_0294Help
Entry
PAS_chr3_0294     CDS       T01092                                 

Definition
(RefSeq) Gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ppa  Komagataella phaffii
Pathway
ppa00330  Arginine and proline metabolism
ppa00332  Carbapenem biosynthesis
ppa01100  Metabolic pathways
ppa01130  Biosynthesis of antibiotics
ppa01230  Biosynthesis of amino acids
Module
ppa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PAS_chr3_0294
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PAS_chr3_0294
Enzymes [BR:ppa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PAS_chr3_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF4224 DUF4135
Motif
Other DBs
NCBI-GeneID: 8200122
NCBI-ProteinID: XP_002492515
UniProt: C4R450
Position
3:581935..583290
Genome map
AA seq 451 aa AA seqDB search
MGENCYTIVVKLGTSSVVDEETREPRIATMSRIVETLVKLRRKGHRIVIVSSGAIAVGMK
RVNMKRKPKKLQQVQALAAIGQGRLIGLWDDLFRQLNQPIAQILLTRTDLVDYTQFKNAE
NTLEQLIKMGIIPIVNENDTLSIQEIKFGDNDTLSAITAGMCHADYLFLVTDVDCLYTDN
PRTNPDAEPIVLVRNMRNLNVNTESGGSAVGTGGMTTKLIAADLGVSAGVTTIICKSEHP
EQILDIVEYSIRADRVENEAKYLVINEEETVEQFQEINRSELRELNKLDIPLHTRFVGHS
FNAVNNKEFWLLHGLKANGAIIIDPGCYKAITRKNKAGILPAGIISVEGNFHEYECVDVK
VGLRDPDDPHSLDPNEELYVVGRARCNYPSNQINKIKGLQSSQIEQVLGYADGEYVVHRD
NLAFPVFADPELLDVVESTLSEQERESKPNK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaaattgttacactatcgtcgttaaattgggaaccagttccgtggtagatgaa
gaaaccagggaaccaagaatcgcaactatgtctcgtattgtcgagacccttgttaagctg
cgaaggaagggccatcgaattgtcatcgtctcctcaggtgccatcgctgtgggcatgaag
agagtcaacatgaagcggaaaccaaaaaagttacagcaagtgcaggcattggctgctata
ggacaaggccgtttgataggactttgggacgaccttttccgtcagttgaatcagcctatt
gcgcagattttactgactagaacggatttggtcgattacacccagtttaagaacgctgaa
aatacattggaacagcttattaaaatgggtattattcctattgtcaatgagaatgacacc
ctatccattcaagaaatcaaatttggtgacaatgacaccttatccgccataacagctggt
atgtgtcatgcagactacctgtttttggtgactgatgtggactgtctttacacggataac
cctcgtacgaatccggacgctgagccaatcgtgttagttagaaatatgaggaatctaaac
gtcaataccgaaagtggaggttccgccgtaggaacaggaggaatgacaactaaattgatc
gcagctgatttgggtgtatctgcaggtgttacaacgattatttgcaaaagtgaacatccc
gagcagattttggacattgtagagtacagtatccgtgctgatagagtcgaaaatgaggct
aaatatctggtcatcaacgaagaggaaactgtggaacaatttcaagagatcaatcggtca
gaactgagggagttgaacaagctggacattcctttgcatacacgtttcgttggccacagt
tttaatgctgttaataacaaagagttttggttactccatggactaaaggccaacggagcc
attatcattgatccaggttgttataaggctatcactagaaaaaacaaagctggtattctt
ccagctggaattatttccgtagagggtaatttccatgaatacgagtgtgttgatgttaag
gtaggactaagagatccagatgacccacattcactagaccccaatgaagaactttacgtc
gttggccgtgcccgttgtaattaccccagcaatcaaatcaacaaaattaagggtctacaa
agctcgcagatcgagcaggttctaggttacgctgacggtgagtatgttgttcacagggac
aacttggctttcccagtatttgccgatccagaactgttggatgttgttgagagtaccctg
tctgaacaggagagagaatccaaaccaaataaatag

DBGET integrated database retrieval system