KEGG   Komagataella phaffii: PAS_chr3_0414
Entry
PAS_chr3_0414     CDS       T01092                                 

Definition
(RefSeq) Calcineurin A
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ppa  Komagataella phaffii
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppa01009]
    PAS_chr3_0414
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PAS_chr3_0414
Protein phosphatases and associated proteins [BR:ppa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     PAS_chr3_0414
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 8199546
NCBI-ProteinID: XP_002492642
UniProt: C4R4H7
Position
3:807077..808816
AA seq 579 aa
MNIMLGKKLAQKRLANENTAKLDNALKVLKNKDEEGLVKRDYSIHITKDGQSLKTTERQV
SSVPPPIATKPSDSELFLENGLPDHEFLRTHFIGQGRLHEYQAIRIIEMATSQFIKEPNL
LEVPAPVTVCGDIHGQYYDLMKLFEVSGHPKDTSFLFLGDYVDRGCFSIECLIYLYSLKL
NYSDTFWMLRGNHECRHLTEYFTFKAECLHKYSEDLYEVCVRSFQGLPLAAIMNKQFFCV
HGGISPHLKSIDDVNRIDRFREPPTKGLMCDLLWADPIEEYDEDDATEDHFVPNTLRGCS
YAFSYEASSAFLKKTGLLSIVRAHEAQDAGFRMYKRTKTMGFPSLLTMFSAPNYLDSYNN
KAAVLKYQDNVMNIRQFSSSPHPYYLPKFMDVFTWSLPFAGDKMVDMLVSILNVCSQKEL
DEETPLAKVPASALENVDKLIKQKKANASKTTQESQIDPMDLEAKKVVLRNKILAIGRVS
RMYQVLRQESENVQKLKSLSVDGQLPPGSLLNGPEGIRQKIHSFDEARKMDLKNEALPPL
PTDFAYQQKLEDERIRRDIEQQVKQDRKFNTLAQRLSDF
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgaacataatgctggggaaaaaactggcccagaaaaggttagctaacgaaaacacggct
aagcttgacaatgcactcaaagtgctaaagaataaggatgaagaggggcttgttaaaaga
gattactcaatccatattaccaaggatggccagtccttaaagactacagagagacaagtt
tcgtccgtaccgccaccaattgctacgaaaccttctgatagcgagttatttttggagaac
ggattgcctgaccacgagtttttgaggactcatttcataggccaaggaagacttcatgaa
tatcaggccattcgtatcattgaaatggcgacttcacaatttattaaagagccaaacttg
ctagaggtacctgccccagtgacagtgtgtggtgacattcatggacagtattatgatctc
atgaaactgtttgaagtttcaggacatcctaaagataccagtttcctatttctgggggat
tatgttgatagaggatgtttttctattgaatgcctcatttatctgtattctctaaagttg
aattatagtgacactttttggatgctaaggggaaatcatgagtgccgtcatttgacagag
tacttcaccttcaaggccgaatgtctccataagtactcagaagacctgtatgaggtttgc
gttcgatccttccaagggcttcctttagcagcaatcatgaataagcagtttttttgtgtt
cacggaggtatatcaccccatttgaaatctattgacgatgtgaatcgtatcgatagattc
agggaacctcctacaaaaggattgatgtgcgatttgctatgggcagatcctatagaggaa
tacgatgaggacgacgccaccgaggatcattttgttccaaacacattaaggggctgctct
tatgcgttttcctacgaggcctcttctgcgtttttgaagaagacaggtctattatcgatt
gttcgtgcccatgaagcgcaagatgcaggatttcgaatgtacaaaaggactaagacgatg
ggatttccttcacttttaacaatgttttcagctcccaactacttggacagttacaacaat
aaggctgcagtgctgaagtaccaggataacgttatgaatataagacaattcagctcatcc
ccacacccatattatcttcccaagttcatggatgtatttacttggtctcttccttttgct
ggcgacaagatggtggatatgctagtttccattcttaacgtttgttctcagaaagaactg
gatgaagagactcctttggccaaagttcctgctagtgccttagaaaatgtagacaaacta
ataaaacaaaagaaagcaaacgcttcaaagactacccaagagtctcagatagaccctatg
gacttggaagccaagaaagtggtactcagaaataagattctggcaattggaagagtatcc
aggatgtatcaagttctccgtcaagagtcagaaaatgtacaaaaacttaagtctctgagc
gtggatggccagctcccccctggttcattgttaaacggacctgaaggaattcgccaaaag
attcactcgtttgatgaagcacgtaaaatggatctcaagaatgaggcactaccgcctttg
cccacggactttgcataccagcagaaactagaggatgaacgtataagacgcgatattgaa
cagcaggttaaacaagaccgaaagtttaacacattggcccaaagactaagtgatttttga

DBGET integrated database retrieval system