KEGG   Komagataella phaffii: PAS_chr3_0781Help
Entry
PAS_chr3_0781     CDS       T01092                                 

Definition
(RefSeq) Glycogen synthase, similar to Gsy1p
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ppa  Komagataella phaffii
Pathway
ppa00500  Starch and sucrose metabolism
ppa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAS_chr3_0781
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppa01003]
    PAS_chr3_0781
Enzymes [BR:ppa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PAS_chr3_0781
Glycosyltransferases [BR:ppa01003]
 Polysaccharide
  Storage polysaccharide
   PAS_chr3_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 8200474
NCBI-ProteinID: XP_002493014
UniProt: C4R5J9
Position
3:complement(1497578..1499689)
Genome map
AA seq 703 aa AA seqDB search
MGKDITNHLLFEIATEVANRVGGIYSVLKSKAPVTVAEYKDRYTLIGPLNANSANVEVEE
LPVLDPVLKRTLDSMSGRGIRYLYGRWLIEGAPRVILFDIGSAAGYLNEWKSDLWNIAGV
PTPEHDVETNDAILLGYLVAWFLGELVHNDGHKRAIICHAHEWLAAVCLPLCRKRKIDVT
TVFTTHATLLGRYLCAGSVDFYNNLDKFDVDAEAGKRGIYHRYCIERAAAHSADVFTTVS
HITAYEAEHLLKRKPDGVLPNGLNVIKFQAVHEFQNLHAEKKEKINEFIRGHFYGQLDFK
LNNTLYFFIAGRYEYRNKGVDFFIESLARLNHRLKASNSNMTVVAFIIMPAKTNSYTVET
LKGQAVIKQLENTINDIEALVGKRLFEFCQHPATSSNSSHIEMPDIDDLLKPSDRVLLKR
RMFAMKREGLPPIVTHNMADDSTDPILNQIRNVQLFNRPEDRVKIIFHPEFLNSNNPILS
LDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCYMEDLIENSSDYGI
YIVDRRLKSVDESIDQLTSYMFDFVDKTRRQRINQRNRVERLSDLLDWRRMGLEYVKGRS
LALRRAYPDEFKNQNNEHSNPFSESNSIKITRPLSVPGSPRDKYSSSANIMTPGDLGTLQ
ENNSTDYISWRLGNDTEEDGLDVTLRGLSVAPSAEQSGDEFDA
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagatatcactaaccacctgttgtttgaaattgcaaccgaagtggccaatcgg
gttggaggaatttactccgtcctgaagtccaaggctccggtgaccgtcgctgaatataag
gatagatacactctaattggccctctcaatgccaacagtgctaacgttgaagtggaagag
ctacctgtattggatccagttctgaagagaactctggactcaatgtctgggagaggcatt
cgttatctctacggtagatggttgattgaaggagccccaagagtaattcttttcgatatt
ggtagcgccgcaggttatttgaatgagtggaaatccgacctgtggaacatcgctggcgtc
cccactccagagcatgatgtcgagacaaacgatgctattcttctgggatacctagtcgct
tggtttttgggagagttggttcacaatgatggccacaagagagcaattatttgtcatgcc
catgaatggctggccgctgtctgtttgcctctttgccgcaaaagaaaaatcgatgtaacc
actgtctttactacgcacgctaccttactgggcaggtacctgtgtgctggttccgttgac
ttctacaacaatctagacaagtttgatgtggatgctgaagctggaaagagaggtatctac
caccggtactgtatcgagagagctgccgcacatagtgccgatgtgttcactacagtgtca
cacatcacggcctacgaggcagaacacctgctcaagcgtaagcctgacggtgtgcttcca
aatggtttgaatgttatcaagttccaagctgttcacgagttccaaaacttgcatgctgag
aaaaaagagaagattaatgagttcattcgtggtcacttctacggacaattggactttaaa
ctcaacaacaccctttatttctttattgctggtagatacgagtatcgtaataaaggtgtc
gatttcttcattgaatcattggcaagacttaatcacaggcttaaggcatccaattctaac
atgactgtggttgcctttattatcatgcctgcaaagacaaactcttacacagtggagact
cttaagggccaagccgttatcaaacagttggaaaacactatcaacgatattgaagctttg
gtcggaaaacggctgtttgagttctgtcaacatccagctacttctagcaactcctctcat
attgaaatgcctgatatcgacgacttgctcaagccatctgatagagtcctgctcaaacgt
cgaatgttcgccatgaaaagggagggattaccacctatcgtcacacacaacatggctgac
gatagtactgatcctattctcaaccagattagaaatgttcagctgttcaacagaccagag
gaccgggtcaaaatcatttttcatcctgaattcttaaactctaacaacccaattctgagt
ttggactacgatgagtttgttagagggtgtcatttgggagtgtttccatcctattatgaa
ccttggggttacactccagcagagtgcacagttatgggtattccttcaatcaccactaat
ttatccggattcggctgctacatggaggacttgatagaaaactcttcagattatggtatt
tacattgtggacagaagattaaaatctgtcgatgagagtattgaccaattgacttcttac
atgttcgatttcgtcgacaagaccagaagacaacgtatcaaccagagaaacagagttgag
cgtctgtctgatctcttagactggcgtcgtatgggattggaatacgttaagggtcgttca
ttggctcttcgcagagcttaccctgacgagttcaagaaccagaacaatgagcactctaac
ccattcagcgaatccaacagtatcaaaatcactcgaccattgtccgtaccaggttcacca
agagataagtactccagcagtgccaacatcatgactcctggagaccttggtacacttcaa
gagaacaattccacagactatatctcgtggagattaggaaatgatactgaagaagatgga
ctagatgtaacgcttcgtggactcagtgtcgccccaagtgccgagcaaagtggtgacgaa
tttgatgcctga

DBGET integrated database retrieval system