KEGG   Komagataella phaffii: PAS_chr4_0062Help
Entry
PAS_chr4_0062     CDS       T01092                                 

Definition
(RefSeq) Vacuolar membrane protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ppa  Komagataella phaffii
Pathway
ppa04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    PAS_chr4_0062
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppa04131]
    PAS_chr4_0062
Membrane trafficking [BR:ppa04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    PAS_chr4_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Clathrin Vps39_1 WD40
Motif
Other DBs
NCBI-GeneID: 8201150
NCBI-ProteinID: XP_002493467
UniProt: C4R6R3
Position
4:123739..126957
Genome map
AA seq 1072 aa AA seqDB search
MVENTENSEKSSIDLSTSDRASQKPELPEAVLVDGNNELAKVDDSGEEERGKKEQEQQED
KEGEEEGHNQQTEEANGSIKTSKAKEENGAAVSVHEASSKDDETLDEQKEGQNGVDKTTE
ASNKVAQQQLDASDNLDSLDSSTSDLSDELQSQSDVNDNPDAELPQFTFHRISQLPPSFM
KHDPISASYIHEKFFLFATHNGFIHISDNNFQEIRTFRAHRASILSLHTDGEYFASASMD
GTVVVGSILNDKDIVAYDFKRPVHAVIIDRQYKVTKSFISGGMSGEVILSTRNWLGQRAD
TVLETEHGPITSIKCVDDLIIWTNDKGITFYQTSTRTMLLNTPLPKGFNRPDIYWPKYSF
PETDRLIVGWNDHVWFYKLTIPQTVQTLQAANFLSTAASSFRIGAVEKSVELESHVHLPD
TIIGGISSINDNLIVLNYLAPVEDKSNNSRRPKMKSAPPELQVIDPWTKEELSVDIIEPK
DYATLGVNDYHLEKSIGEMVRWFLISPNDAILIKEFSLHDQLEWYIEHKMYQKAWSISEY
ILPPLERITLGVQQVHEYINSEKWSEAGELLTKVLAHSDDTSKEHQEYIKGEWANFLDLF
FEKGHQDQIVDCIPKVYFPNSAVNIDPKIYGKYLEHYLTDWKNIPKFLQLYHDWDHRLLD
LRYFQFLLDNTLNSNQNESNNKMPMVDKIRFLFIELCLEIDDPQPAVKHLIIMRDPGTLQ
FLISNHILGKFVDRLPEILTLELNDEELQYATVDFIREKLTTNIELLASKHREIMPSKII
ELNERAGLSVINYLYLEKLSQLDKLLTKDFEDEMVMLYAKFNVSLLYNFLSKHNNYNIDS
AIEICEEMHCYKELVYLWGKIGKNKKAVTLIIDKLEDPDLAIQFVATNNDSELWDYLLEY
SMDKPKFIKALITAANSSQYFNNMDDPFVLKIDPISIVKRIPERIEIEGLKRALMNITYD
NYLELTINKIILQIIQEETLEIGNFYRKERLKGATLEPRQNSKFLKETVIMYSDPAKPLV
TETEVVGEGNEWKQVVNEDDNATIDISTKISHLNYIRQKLVLLRLRSENGRT
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaatacagaaaattcagaaaagagctcaattgatctcagcacatctgataga
gctagtcaaaaaccagaattacctgaagcagttttggttgatggcaataatgagttggca
aaagttgacgatagtggagaagaagaacggggcaaaaaagaacaagaacaacaagaagac
aaggaaggagaagaagaaggacataaccagcaaaccgaggaagctaatgggtcgataaag
acatccaaagcaaaagaagagaatggggccgcggtcagtgttcatgaggcatcgtccaag
gatgacgaaacattagatgaacagaaagaggggcagaatggcgtggacaagacaacagag
gcaagcaacaaagtagcacagcagcaacttgatgcatccgataacctagattctttagat
tcttctacctcagacctatccgatgaactccaatctcaatcggacgtcaatgataatccc
gatgcagagctaccacagtttacattccataggataagccagttgcccccttcatttatg
aagcatgatcctatatctgcttcctatattcatgaaaagttttttttatttgctactcac
aacggctttattcacatttccgataataattttcaagagataagaacttttagagctcac
agagcctccattctatcccttcatacagatggggaatactttgcatctgcttctatggat
ggaacagttgtagtcggttctattcttaacgacaaggatatagtagcttatgacttcaaa
cgtcctgtgcatgctgtgattattgatcggcagtacaaggtgaccaagtctttcatttcc
ggaggaatgtcaggagaggttatcttgtcaacgagaaattggctgggccaacgagctgat
acagtactagaaacagagcacggccctatcacttctatcaaatgtgtcgacgatttgata
atttggactaatgacaagggcatcacattttatcaaacatctacccgaactatgcttttg
aacacacctttgcccaaaggctttaacaggcctgatatttactggcctaagtactccttc
cctgaaacggatcggctcattgttggatggaatgatcatgtctggttctataaactaact
attcctcaaactgttcagacactacaagctgccaattttctcagtacagcggcttctagc
tttaggataggcgctgtagagaaaagcgttgaacttgaatctcatgttcatttgccagat
actatcattggtggaatttcctccataaatgacaatttaattgttttgaattacctagca
cctgttgaagacaaaagcaacaattcaagaaggccaaaaatgaaatcggctcctcctgaa
ctgcaagttatcgatccttggacgaaagaggaattgtcagtggatattattgaacctaaa
gattatgcaacgttgggggtaaacgattatcatcttgaaaaatcaattggcgaaatggtc
agatggttcctaatctcacccaatgacgctatccttatcaaggaattctcgcttcatgac
cagctagagtggtatattgaacacaagatgtatcagaaggcttggagtatttctgaatat
attcttccaccattagagagaattactctaggggtgcagcaggtgcatgaatatatcaat
agtgaaaaatggagcgaagcaggcgagcttcttaccaaagtgctagctcacagtgatgat
acttcaaaagaacatcaagaatacattaaaggggaatgggcaaattttttagacctattt
tttgaaaaaggacatcaggaccaaatcgttgattgcatccccaaggtgtatttcccgaac
tcagcagtgaatattgaccccaagatatacgggaaatatttggaacattatctaactgac
tggaaaaatatacccaagtttttacagttgtatcatgactgggatcacagattactggat
ttgagatatttccagttcttgttggacaatactttgaatagcaatcaaaatgaatctaac
aataaaatgccaatggtcgataagattcgctttttgtttattgaattgtgtctagaaatt
gatgatcctcagccagcagttaaacatttaatcataatgagggatcctggaactctacag
ttcttgataagcaatcacatacttggaaagtttgtcgatagacttccagagattttaacg
ttggagttgaatgatgaagaattacagtatgctactgtagactttattagagaaaagctg
accacaaatattgagctacttgccagcaagcacagggaaataatgccatcaaaaatcatt
gaattgaatgaaagggcaggattatctgtaatcaattacctgtatttggaaaaactttcc
cagctagataagctattgaccaaagattttgaagatgagatggttatgctttacgccaaa
tttaacgtttctttactttacaactttctttcaaagcacaacaattacaacatagattca
gcaatagagatttgcgaagagatgcattgctataaagaactagtttatttatggggcaag
attggtaaaaacaagaaggctgtcactctgattatagataaactggaagacccagatttg
gctattcaatttgttgcaactaacaatgattctgagctatgggactacctgttagaatat
tccatggataaacccaaatttatcaaggcgctgattacagctgctaacagttcgcagtat
ttcaataacatggacgacccgtttgtgctgaagattgaccccatttcaattgttaagcga
atcccagaaagaatcgagattgaagggctaaagcgtgccttgatgaatattacttacgat
aactatctggagttgaccatcaacaaaattatcttacaaatcattcaagaagagacactt
gagattggaaatttttacaggaaagagagactaaaaggggcaactttggaaccaagacaa
aattcaaaatttttgaaagagacggtgatcatgtactcggatcctgcaaagccactagta
acagagactgaagttgttggtgaaggaaatgagtggaagcaagtcgtgaatgaagatgat
aatgccactatagacatttccaccaagataagtcatttgaactacatcaggcagaaactg
gttttattaagattgagaagtgaaaacggtcgtacctga

DBGET integrated database retrieval system