KEGG   Komagataella phaffii: PAS_chr4_0352Help
Entry
PAS_chr4_0352     CDS       T01092                                 

Definition
(RefSeq) Long chain fatty acyl-CoA synthetase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
ppa  Komagataella phaffii
Pathway
ppa00061  Fatty acid biosynthesis
ppa00071  Fatty acid degradation
ppa01100  Metabolic pathways
ppa01212  Fatty acid metabolism
ppa04146  Peroxisome
Module
ppa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAS_chr4_0352
   00071 Fatty acid degradation
    PAS_chr4_0352
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PAS_chr4_0352
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppa01004]
    PAS_chr4_0352
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppa04147]
    PAS_chr4_0352
Enzymes [BR:ppa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     PAS_chr4_0352
Lipid biosynthesis proteins [BR:ppa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   PAS_chr4_0352
Exosome [BR:ppa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   PAS_chr4_0352
  Exosomal proteins of breast cancer cells
   PAS_chr4_0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 8200793
NCBI-ProteinID: XP_002493775
UniProt: C4R7M1
Position
4:711122..713347
Genome map
AA seq 741 aa AA seqDB search
MSHLKKIQDRTPVESLSPQDKKEIKSLFDSLPLPSSDLANSYAVPGSAKTGYSPTFRNSY
VRNGSLIETLHPSLRTLHELFSNSVQLYGERDCLGSRLYDHDVKDGYDDYFTFENYRTIC
ERKSNLGAGIIHSVLDNEYRIDPKDGGFDLADYNTNNFIVSLYGRNRAEWVLSDLACQTY
SLPDTALYDTLGPTTSAYILELTKSPVVICCAEKIEKLIELKTNNPESLKHFITIISMDN
LDFQDFSINDLIKRANSVQIKLLDLGQTEELGKASPVAEIPPLPSTIYTISFTSGTTGVP
KGVVLTHKIATAAATFALSHIGLPDSGRTLSILPLAHIFERQVSNLALVAGVALTFPHLP
GPEHIVPNLRISKPCALTAVPRLYNKFESAIKSSLLSGPETITQKLVSAIISQNIRTQSA
KDGNKGNNFISRQLVTKKIRASLGLDNCQFLVTGSAPIDPETMKFLKGSLGVGFMQGYGL
TECYAGICISSAYLKENGSCGAIGISAEMRLRDVPEMNYFSGKQLADGSYHGELQLRGPQ
VFSYYYKRPDETEKAFDKDGWFCTGDIARIDKNGKLYIIDRVKNFFKLSQGEYVTPEKIE
NIYLSSSPLISQVFIHGDSLHSFLVAVVGVDETFFNNLRSVDPSIIKNYELKSTEDTIEK
CNANKDLKRSLLFLFNKSVESAGLLGFEKIHNFHLAFEPLKIEDDTLTPTFKLRRVQAKH
KFDTELANLYNEKSLLRETKM
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatctcaaaaagatccaggataggactccggtcgagagtttgtcacctcaggac
aaaaaggaaatcaagtcgctctttgacagtctgccattgccctcttctgacctagctaac
tcctacgcagtcccagggtcagccaaaactggatattcacctacattcagaaatagttat
gtcagaaacggatcgttgatcgagacgctacatccttctctgaggactctgcatgagttg
ttcagtaactctgttcagttgtatggagaaagggactgtttgggttctagactttatgac
catgatgtaaaggacggttatgacgattatttcacgtttgagaactacaggacgatttgc
gaacgaaagtctaatttgggagctggtataattcattccgtgctagataacgaatacaga
attgacccaaaagacggcggttttgaccttgcagattataacaccaataacttcattgtc
agtctgtatggtagaaatagggctgaatgggtgctatctgatttggcctgtcaaacctac
agtttaccggacactgcattgtatgatacattaggacccacaacttccgcttatatcctt
gagctgacaaagtctccagtagtaatttgctgcgctgagaagattgaaaaacttattgag
ctcaagacaaacaatccagagtcactcaagcattttatcaccatcatttctatggataat
cttgattttcaagatttttccatcaacgaccttataaaaagagccaacagtgttcaaatt
aaactgttagatttgggacaaacagaagagctgggtaaggcttctcctgtggcagaaata
cctccacttccttcgaccatatacactatttcgtttacctcaggaaccactggagttccc
aagggagtagtattgacacacaaaatagccactgcagcagccacgtttgctttatcgcat
atagggcttcctgacagcggaagaacgctgagtattcttcccttggctcatatttttgaa
aggcaagtatccaatctagcgcttgtcgctggagtagctttaacattcccacatctccca
ggcccagagcatattgttccaaaccttcgtataagtaaaccttgtgctctaactgctgtg
ccgagattgtataacaagtttgaaagtgcaatcaagtcttcccttctaagtggaccggag
acaattacccagaagctggtttccgccataattagccaaaacatccgaactcaatcggcc
aaagatgggaataagggcaacaattttatttcacgacaattggtcacaaagaaaatcagg
gcatctttaggattagataactgtcaattcttggttactggctcagcacccattgaccca
gaaacgatgaagttcttgaagggatctctaggagttggatttatgcaaggttatgggcta
acggaatgttatgctggaatctgcatctcatcagcttatctgaaagaaaatggttcctgt
ggtgccattgggatatctgctgaaatgaggttgagagatgtgcctgaaatgaactatttc
tctggaaaacaacttgcggatgggtcgtatcacggtgagctgcaattacgtggtcctcag
gttttcagctactactataaaagacccgatgagactgaaaaagcatttgataaagacggc
tggttctgtactggagatattgctagaattgacaaaaatggaaagctttacattattgac
agagttaagaattttttcaaattatcccaaggggagtacgtaacaccagagaaaattgag
aacatttaccttagtagttctcctttgatttcacaagttttcattcatggtgactctctg
cattcttttttggtggctgttgttggtgtagatgaaacgtttttcaataatttgagatca
gttgacccgtcaatcattaagaattatgaactcaaatccactgaagacaccattgaaaaa
tgcaatgctaataaagatttgaagagatctcttctctttctattcaataagagtgtcgaa
agtgctggattgttgggttttgaaaaaatccacaactttcaccttgcgtttgaaccgtta
aagattgaagacgatactctgactcctacgtttaaacttcgtagggttcaagccaagcac
aaatttgacaccgaattggctaatttgtacaatgagaagagtcttctgagggagactaag
atgtag

DBGET integrated database retrieval system