KEGG   Komagataella phaffii: PAS_chr4_0692Help
Entry
PAS_chr4_0692     CDS       T01092                                 

Definition
(RefSeq) Sporulation-specific exo-1,3-beta-glucanase
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
ppa  Komagataella phaffii
Pathway
ppa00500  Starch and sucrose metabolism
ppa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAS_chr4_0692
Enzymes [BR:ppa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     PAS_chr4_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase FG-GAP_2
Motif
Other DBs
NCBI-GeneID: 8200588
NCBI-ProteinID: XP_002494132
UniProt: C4R8M8
Position
4:1331602..1332864
Genome map
AA seq 420 aa AA seqDB search
MMISAFVWSSLIVGLISGLLALEHPQFKEFSNRTIIQHNDLLERNRSTSRFDKPPKLYGV
ALGGWLVLEPYITPSLFNDTVEETVDEYTLCHKLGKQKATEVLKKHWSTFITESDIIKIK
NVGLNSVRIPIGYWAYDLLEDDPYIQGQDEFLSQCIDWCAKHGLSVWIDLHGAPSSQNGF
DNSGRRGRAGWQDEQRYIDKTLYVLETIAKRHGNKSNVIGIEILNEPFGPVLNIEKLKQF
YQKGITVIRNTGYSKDIVISDAFQGIFYWNDFQPSDSNLILDRHHYEVFSDGQLRSSFEG
HLRGIEAFGRAIAIEKPTVVVGEWSAAITDCAPWVNGAGRPSRYHGMVLEDGTVGDCSGA
TNIEQWAGKRREEFLKIIETSLKAYNAADGWFFWCWKTESALEWDMEKLLHYTLFPSGWV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgatgattagtgcgtttgtttggtcaagtctaattgttggtctaatttctggcttgttg
gcccttgaacatcctcagttcaaggaattttctaaccgcacaattattcaacataatgat
ttacttgaaagaaaccggtcaacaagtagatttgataaaccacctaaattatacggagtt
gcattgggtggctggcttgttcttgaaccatatatcacccccagtcttttcaatgatacc
gtggaagaaactgtggacgagtacactctatgtcataaactaggcaagcaaaaagctact
gaagtgctaaaaaagcattggtcgacttttattacggaaagtgacattatcaagattaag
aacgttggtttgaacagtgtaagaattcccattggctactgggcgtatgatcttcttgaa
gatgatccttatattcagggtcaagatgaatttttatcccaatgtatagactggtgtgcc
aaacatggtctgagtgtttggatagatttgcatggtgctcctagttcacaaaacggattt
gacaattctgggcgtagaggaagagctggatggcaggatgagcagaggtatattgacaag
acattatatgtgctagaaacaattgccaaacggcatggaaataaatccaatgttattgga
atcgaaattctaaacgagccttttggcccagttttgaacattgaaaagttaaaacagttc
tatcaaaaggggataacggtgattaggaatacaggctactccaaagatatagtgatatct
gatgcattccaaggaatattttattggaacgattttcagccctcagattcaaatcttatt
ctagatagacaccattacgaagttttctccgatggacagctaagatccagtttcgaaggt
catctgaggggtattgaggcttttggcagggccattgccatagagaagcctacagtagta
gttggagaatggtctgcagctattacagattgtgctccctgggtcaatggtgccggaaga
ccttcaagatatcatggaatggttcttgaagatggaacggttggagattgttctggtgct
accaacattgaacagtgggcagggaaaagacgtgaagaatttttaaagataatcgagact
tcattaaaggcctacaatgcagctgacgggtggtttttctggtgttggaaaaccgaatcc
gctttggaatgggatatggagaagctcttacattatactctttttccctcgggttgggtt
taa

DBGET integrated database retrieval system