KEGG   Palaeococcus pacificus: PAP_06050Help
Entry
PAP_06050         CDS       T03210                                 

Definition
(GenBank) NDP-sugar synthase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ppac  Palaeococcus pacificus
Pathway
ppac00051  Fructose and mannose metabolism
ppac00520  Amino sugar and nucleotide sugar metabolism
ppac01100  Metabolic pathways
ppac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PAP_06050
   00520 Amino sugar and nucleotide sugar metabolism
    PAP_06050
Enzymes [BR:ppac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     PAP_06050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AIF69610
UniProt: A0A075LS96
Position
complement(1086365..1087606)
Genome map
AA seq 413 aa AA seqDB search
MKAVILAGGFGTRLRPISSTRPKPMVPVLGKPNLQYLLESLEKVKEIDEIILSVHYMKGE
IREFIEDNMADYPKDIRFVNDPMPLETGGALKNVEEFVSEDFLVIYGDVFTNFDFGELIE
AHKKNGGLVTVAVTKVYDPEKYGVVELNEEGKVVEFEEKPRRPKTNTIDAGIYVVNKEVL
KDVPKNKEIYFEREILPKYVSQGLVYGYKMARDTYWVDLGTPEDLFYAHQIILDEITKEN
GYYTIKEGAEVAEDVEIQGPAYIDRGAKVGKGVKIKAYTYIGPNTIIKEKAYLKRAILIG
SDIIKEKSEIKDSILGEGVVIGQNVIVKENAVIGDYAKIYDNLVIYSAKVLPWKKVEEYE
AWLKLKLDPTKVRPELTPDRCPLGLPECIYKKFKAMAGEKPPCDECIENQWLF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttattcttgctggaggattcggaacgaggttaaggccaatttcatccaca
agaccaaagccgatggtacctgttctcggaaagccaaacctccaatatctcttggagagc
ttagaaaaagttaaagaaattgacgaaataattctctcagttcattacatgaagggagaa
atcagagagttcatagaggataatatggcggattacccaaaagacatccgctttgtaaac
gacccaatgcctctcgaaacaggaggagcactcaaaaatgttgaagaattcgttagcgag
gactttttggtcatctacggagatgtgtttacaaactttgactttggggagctcatagaa
gcccacaaaaagaacggtggcttagtcactgttgccgttacaaaagtatatgacccagag
aagtacggtgtggttgagctaaacgaggaaggaaaagttgtggagttcgaagagaagcct
agaagacccaagacaaacacaatcgacgctggaatatacgttgtgaacaaggaagtctta
aaggatgttccaaagaacaaagaaatctactttgagagggagatacttccaaaatatgtg
agccagggactagtttacggctataagatggcgagggatacatattgggttgacctcgga
actcccgaagacctgttctacgcccaccagataatccttgatgagataaccaaggagaac
ggttactacaccataaaagagggtgcagaagtcgcagaggatgtcgaaatacaggggcct
gcgtacatagataggggggcaaaggtcgggaaaggcgttaagataaaagcctatacatac
attggaccgaacaccataattaaagaaaaggcctacttaaagagggcaatacttatcgga
agcgacataatcaaagagaagagcgaaattaaagactcaatactcggtgaaggcgttgtt
attgggcagaacgtcatagttaaagagaacgctgtaataggagactacgcaaagatttac
gacaacttggtaatctacagtgctaaggtgcttccatggaagaaggtagaggagtatgag
gcttggctcaagctcaagctcgacccaaccaaggttaggcccgagctcacgccagacaga
tgcccacttggacttccagagtgcatttacaagaagttcaaggccatggccggggaaaag
cccccatgcgatgagtgtattgagaaccaatggctcttctga

DBGET integrated database retrieval system