KEGG   Panthera pardus (leopard): 109246985
Entry
109246985         CDS       T06062                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00100  Steroid biosynthesis
ppad01100  Metabolic pathways
Module
ppad_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    109246985 (TM7SF2)
Enzymes [BR:ppad01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     109246985 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 109246985
NCBI-ProteinID: XP_019270884
UniProt: A0A6P4TFB4
Position
Unknown
AA seq 437 aa
MAYPRGSRAPLEFGGPLGAAALMVLLPATMFHLLLVARSGPARLLGPPPYLPGPDVLWSP
RVLLLWLAWLGLQAALYLLPARKVAEGLELKDKSRLRYPINGAWGILAPDLCPVGVEIQA
QWRLAPDPKLRYICCYSVHQSSGRIDPLKAKGKVPDLPGLWTVCVCVCVLGWGXPPSALA
PGGTSGNPIYDFFLGRELNPRICSFDFKYFCELRPGLIGWVLINLALLMQEAELRGSPSL
AMWLVNGFQLLYVGDALWHEEAVLTTMDITHDGFGFMLAFGDLAWVPFTYSLQAQFLLHH
PQPLGLPMASAICLINALGYYIFRRANSQKNTFRKNPSDPRVAGLETIPTATGRQLLVSG
WWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFYFLYFTALLVHREARDEQQCLQKYGLA
WQEYCRRVPYRILPYVY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcctatcctcggggctcccgggctccgctggaattcgggggacccctgggcgccgcg
gcgctgatggtgctgctccccgccaccatgttccacctgctcctggtggcccgctcgggc
ccggcgcgcctgctgggcccacccccctacctgccgggtcccgacgtgctgtggagcccg
cgggtgctgctgctgtggctcgcctggctcggccttcaggcggctctctacctactgccg
gcgcgcaaggtggccgaggggctggaattgaaggacaagagtcgcctgcgctaccccatt
aacggtgcctgggggatccttgcgccggatttgtgcccggtgggggtggagatccaggcc
cagtggcgattagcccccgaccccaagctccgatacatttgctgctactctgtgcaccag
agtagtggtcggattgacccactgaaagccaagggcaaggtccctgaccttcctgggctt
tggactgtgtgtgtgtgtgtgtgtgtgttggggtgggggntccctccctccgccctggca
cctggggggacctcaggcaaccccatctacgactttttcctgggacgggagctcaacccg
cgcatctgttcctttgacttcaaatatttctgtgaactgaggcctggcctcatcggctgg
gtcctcatcaacctggccctgctgatgcaggaagcggaacttcgggggagtccctcactg
gccatgtggctggtcaacggcttccagctactctatgtgggtgatgctctctggcatgag
gaggctgttctcaccaccatggacatcacgcacgacgggtttggcttcatgctggccttt
ggggacctggcctgggtacccttcacttacagcctgcaggcccaatttttgctgcaccac
ccgcagcccctggggttgcccatggcctccgccatctgtctcatcaacgctcttggttac
tacatcttccgaagagccaattcccagaagaacaccttccgaaagaatccttctgacccc
agagtggctggcctcgagaccatccccacggccacggggcggcagctgctggtgtccggg
tggtggggtatggtccgccaccccaactacctcggggacctcatcatggctctggcgtgg
tccttgccctgcggggtgtctcacctgctgccctatttctacttcctctacttcacggcg
ctcctggtgcaccgggaggcccgggatgaacagcagtgcctacagaagtacggcctggcc
tggcaggagtactgccggcgcgtgccttaccgaatcctgccctacgtctactga

DBGET integrated database retrieval system