KEGG   Panthera pardus (leopard): 109247377
Entry
109247377         CDS       T06062                                 

Gene name
NPEPPS
Definition
(RefSeq) puromycin-sensitive aminopeptidase
  KO
K08776  puromycin-sensitive aminopeptidase [EC:3.4.11.-]
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109247377 (NPEPPS)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109247377 (NPEPPS)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109247377 (NPEPPS)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 109247377
NCBI-ProteinID: XP_019271484
Ensembl: ENSPPRG00000020677
Position
Unknown
AA seq 919 aa
MWLAAAAPSLARRLLFLGPPPPPLLLLLLSRSSRRRLHSLGRAAMPEKRPFERLPADVSP
INYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDIITASYAPEGDEEIHATGF
NYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRSKYTTPSGEVRYAAVTQFE
ATDARRAFPCWDEPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENVVEVKFARTPV
MSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPY
PLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFG
NLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIE
VSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDFKKGMNMYLTKFQQKNAATEDLWE
SLENASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRLLRLSQRKFCASGPYAGEDCPQW
MVPITISTSEDPNHAKLKILMDKPEMNVVLKNVKPDQWVKLNLGTVGFYRTQYSSAMLES
LLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTVEVLKVMEAFVNEPNYTVWSDLSCNLG
ILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWDPKPGEGHLDALLRGLVLGKLGKAGHKA
TLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIE
RVLGATLSPELIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYN
RYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKR
DAESIHQYLLQRKASPPTA
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgtggctggcagccgccgccccctccctcgctcgccgcctgctcttcctcggccctccg
cctcctcccctcctccttctcctcctcagccgctcctctcgccgccgcctccacagcctg
ggccgcgccgcgatgccggagaagaggcccttcgagcggctgcctgccgatgtctccccc
atcaactacagcctttgcctcaagcccgacttgctggacttcaccttcgagggcaagctg
gaggccgccgcccaggtgaggcaggcaaccaatcagattgtgatgaattgtgctgatatt
gacattattacagcttcatatgcaccagagggagatgaagaaatacatgctacaggattt
aattatcagaatgaagatgaaaaagtcaccttgtcttttcctagcactctccaaacaggt
acaggaaccttaaagatagattttgttggagagctgaatgacaaaatgaaaggcttctac
agaagtaaatatactaccccttctggagaggtgcgttatgctgctgtcacacagtttgag
gctacggatgctcggagggctttcccttgctgggatgagcctgccatcaaagcaactttt
gatatctcattggttgttcctaaagacagagtagctttatcaaatatgaatgtaattgat
cggaaaccgtaccctgatgatgaaaatgtagtggaagtgaagtttgcccgcacacctgtc
atgtctacatatctggtggcatttgttgtgggtgaatatgactttgtagaaacaaggtca
aaagatggtgtgtgtgtccgtgtttacacccctgttggcaaagcagagcaaggaaaattt
gcgttagaggttgctgctaaaaccctgcctttttataaggactacttcaatgttccttat
cctctacctaaaattgatctcattgctattgcagactttgcagctggtgccatggagaac
tggggccttgttacttatagggagactgcattgcttatcgatccaaaaaactcctgttct
tcatcacgccagtgggttgctctggttgtgggacatgaactcgcccatcaatggtttgga
aatcttgttactatggaatggtggactcatctttggctaaatgaaggctttgcatcatgg
attgaatatctgtgtgtagaccactgcttcccagagtatgatatctggactcagtttgtt
tctgctgattacacccgtgcccaggaacttgacgctctagataacagccatcctattgaa
gtcagtgtgggacatccttctgaagtcgatgagatatttgacgctatatcatatagcaaa
ggtgcatctgtcatccgaatgctccatgactacattggggataaggactttaagaaagga
atgaacatgtatttaaccaagttccaacaaaagaatgctgccacagaggacctctgggaa
agtttagaaaatgctagtggtaaacctatcgcagcggtgatgaatacctggaccaaacaa
atgggatttcccctcatttatgtggaagcagaacaggtagaagacgacagattattgagg
ttgtcccaaagaaagttctgtgccagtggaccatatgctggagaagactgtccccagtgg
atggttcccatcacaatctctactagtgaagaccccaaccatgccaaactgaaaattctg
atggacaagccagagatgaatgtggttttgaaaaatgtcaaaccagaccagtgggtaaag
ttaaacctgggaacagttgggttttatcggacccagtacagctcagccatgctggaaagt
ttattacccggcattcgtgacctttctctgccccctgtggatcgacttggattacaaaat
gacctcttctccttggctcgagctggaatcattagcactgtagaggttctaaaagtcatg
gaggcttttgtgaatgagcccaattatactgtatggagcgacctgagctgtaacctgggg
attctctcaactctcttgtcccacacagacttctatgaggaaatccaggagtttgtgaaa
gatgtcttttcacccataggggagagactaggctgggaccccaaacctggagaaggtcat
ctagatgcactcctgaggggcttggttctgggcaaactaggaaaagcaggacataaggca
acattagaagaagcccgccgtcggtttaaggaccacgtggaagggaaacagattctctcc
gctgatctgaggagtcctgtttatctgaccgttttgaagcatggtgatggcactacctta
gacattatgctaaagcttcacaaacaagcagatatgcaggaagagaaaaaccgaattgaa
agggtccttggggctactctttcacctgaattgattcaaaaagtcctcacgtttgcactt
tcagaagaggtacgcccacaggacactgtgtcagtaattggtggagtggcaggaggcagc
aagcatggaaggaaggctgcttggaagtttataaaagacaactgggaagaactttataat
cgataccagggaggattcttaatatccagactaataaagctatcagttgagggatttgca
gttgataaaatggctggagaggttaaggctttcttcgagagccacccagctccttcagct
gagcgcaccatccagcagtgttgtgaaaatatcctgctgaatgctgcttggctaaagcga
gatgctgagagcattcaccagtacctccttcagcgaaaggcctcgccacctacggcgtga

DBGET integrated database retrieval system