KEGG   Panthera pardus (leopard): 109248181
Entry
109248181         CDS       T06062                                 

Gene name
ENPEP
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    109248181 (ENPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109248181 (ENPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppad04147]
    109248181 (ENPEP)
   04090 CD molecules [BR:ppad04090]
    109248181 (ENPEP)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     109248181 (ENPEP)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109248181 (ENPEP)
Exosome [BR:ppad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109248181 (ENPEP)
CD molecules [BR:ppad04090]
 Proteins
  109248181 (ENPEP)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Cyclophil_like DUF1570
Other DBs
NCBI-GeneID: 109248181
NCBI-ProteinID: XP_019273183
Ensembl: ENSPPRG00000010666
Position
Unknown
AA seq 952 aa
MNFAEEEASKRYCIKTKHVAIICAVVVGVGLIVGLSVGLTRSNHSTGDAGQGTAPAPSHS
PSTESPPQDQGVCPDSEDESGDWKNFRLPDFINPVHYDLQVKPLLEEDTYTGSVTISIKV
SAPTRHLWLHLRETRLTQLPQLRRPSGEQVQVRRCFEYKKQEYVVVEAGEELAPSSGQDV
YLLTMEFAGWLNGSLVGFYRTTYVENGQIKSIAATDHEPTDARKSFPCFDEPNKKATYTI
SIIHPKEYKAISNMPVEKEESVDDKWNRTTFKKSVPMSTYLVCFAVHQFDRVDRISKRGV
PLTIYVQPEQKHTAEYAATITKIVFDYFEEYFAMDYALPKLDEIAIPDFGTGAMENWGLI
TYRETNLLYDPQESASSNRQRVASVVAHELVHQWFGNIVTMEWWEDLWLNEGFASFFEFL
GVNQAEKEWQMRDQMLLEDVLPVQEDDSLMSSHPIVVTVTTPAEITSVFDGISYSKGVSI
LRMLEDWITPEKFQKGCRIYLKKHKFGNAKTEHFWRALEEASNLPVKEVMDTWTKQMGYP
VLNVKDMRNITQKRFLLDPKANSSEPHSALGYTWNIPVKWTEDNVSSITFYNRSETGGIT
LNSSNPAGNVFLKINPDHIGFYRVNYEVPTWEWIATNLSFNHKGFSSADRASLIDDAFAL
ARAQLLDYKMALNLTKYLRKEEDFLPWQRAISAVTYIISMFEDDKELYPVIEEYFRSQVK
PIADFLGWNDVGDHLTKLLRASVLGLACKMGDQEALDNATQLFQQWLSGTVRLPVNLRLL
VYRYGMQNSGNETSWNYTLDQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDFLKDPNLI
KTQDVFTVIRYISYNSYGKTMAWNWIQLNWDYLVNRYTLNDRNLGRIVTIAEPFNTELQL
WQMESFFKKYPEAGAGEKPRQQVLETVKNNIEWLKQNRNTIRQWFLDLPKNG
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgaactttgcggaggaagaggcctccaagagatactgcattaaaacgaaacatgtggct
attatctgtgcggtggtggtgggggtaggattaatagtaggactttccgtgggcttgacc
aggtcgaatcactccaccggggacgctgggcagggcacagctccggctccttcccactct
ccttccaccgagagcccgccacaggaccagggggtctgccctgacagcgaagatgaaagt
ggagactggaaaaacttcaggctgccggacttcatcaatccagtgcactacgacctgcag
gtgaagcccctgctggaggaggacacgtacacaggcagcgtgaccatctccatcaaagtg
agcgcgcccacccggcacctgtggctgcacctgcgggagaccaggctcacccagctcccg
cagctgaggaggccctcgggggagcaggtgcaagtcaggcggtgcttcgagtacaaaaag
caggagtacgtggtggtggaggcgggagaggagcttgcccccagcagtggccaggatgtc
tacctcctgaccatggagttcgccggctggctgaacggctcgctcgtggggttttacaga
acgacttacgtggagaacggacagatcaagagcatagcagccactgatcatgaaccaaca
gatgccaggaaatccttcccttgttttgatgagcccaacaaaaaggcaacctatacgata
tccatcatccaccccaaagaatataaggcaatttcaaatatgccagtggagaaagaagag
tcagtggacgataaatggaatagaacaactttcaagaagtccgtccctatgagcacctac
ctggtgtgctttgctgtacatcaatttgaccgcgttgacagaatatctaaaaggggagta
cctctcactatatatgtccagccagagcaaaagcacacagctgaatatgctgcaaccata
actaaaattgtgtttgattattttgaagaatactttgctatggattatgctcttcctaaa
ttagatgaaatcgctattccagacttcggcaccggggctatggagaactggggactaatc
acttacagagaaacaaatttgctttatgaccctcaggaatcagcttcatcaaaccggcag
agggtggccagtgtggttgcccatgaacttgtgcatcagtggtttggaaatattgtgacc
atggaatggtgggaagacttgtggctgaatgaaggctttgcttccttctttgagttcctg
ggagtaaaccaagcagaaaaagagtggcaaatgagagatcagatgttacttgaagacgtg
ttacctgtacaagaggacgattctttgatgtcttcgcacccaattgttgtcactgtgaca
actcctgctgaaataacatctgtctttgatggaatatcctatagcaagggcgtttccatt
ctgaggatgcttgaagactggataaccccagagaagtttcaaaaaggatgtcggatttac
ttgaaaaaacacaaatttgggaatgcaaaaactgagcatttttggagagcacttgaagag
gcaagtaatttaccagtgaaagaagtaatggatacgtggaccaaacagatgggttatcct
gtacttaatgtgaaagatatgaggaacatcacacagaaacgttttctgttggacccaaaa
gcgaattcttctgagccacattcagctcttggttacacatggaatattccagttaaatgg
actgaagataatgtatcaagtattacattctacaacaggtcagaaacaggaggaatcact
ttgaactcttctaatcctgctggaaatgtttttctcaaaataaacccagatcatattggg
ttttatcgtgtaaattatgaagtaccaacttgggaatggatagctaccaatctttccttc
aaccacaaggggttttcttctgctgaccgcgcaagtcttatcgatgatgcttttgccttg
gcaagagctcaacttctagattataagatggctctaaacttgaccaagtatctcagaaag
gaagaagattttttaccatggcagagagcaatttcagccgtaacctatatcattagcatg
tttgaagatgataaagagctttaccctgtgattgaggaatacttccggagtcaagtgaag
cccattgcagattttctgggatggaatgatgttggagaccaccttacaaagttactacgt
gcttccgtattagggcttgcgtgcaagatgggagatcaagaagctttggacaatgctacc
caattatttcagcagtggctgagtgggactgtaaggcttcctgtaaacctcaggcttctg
gtatatcggtatggaatgcagaactctggtaatgagacttcatggaactatactcttgat
caataccagaaaacttcattagctcaggaaaaagaaaaactactgtatggattagcctca
gtgaagaatgttactcttctgtccagatatttggattttctcaaggacccaaatcttatt
aaaactcaggatgtgtttacagtcatccgatatatctcatataacagctatgggaagacc
atggcctggaattggattcaactcaactgggactatctagtcaacagatatacactcaat
gacagaaaccttggcagaattgtcaccatagcagaaccattcaacaccgaactgcagctc
tggcagatggaaagctttttcaaaaaatatccagaagctggagcaggagaaaaacctagg
cagcaagtgctggaaacagtgaagaacaatattgagtggttaaaacaaaatagaaacacc
ataagacaatggtttttggatttacctaagaatggttaa

DBGET integrated database retrieval system