KEGG   Panthera pardus (leopard): 109249043Help
Entry
109249043         CDS       T06062                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04727  GABAergic synapse
ppad04742  Taste transduction
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04924  Renin secretion
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04961  Endocrine and other factor-regulated calcium reabsorption
ppad04962  Vasopressin-regulated water reabsorption
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05032  Morphine addiction
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109249043 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109249043 (ADCY6)
   04371 Apelin signaling pathway
    109249043 (ADCY6)
   04072 Phospholipase D signaling pathway
    109249043 (ADCY6)
   04024 cAMP signaling pathway
    109249043 (ADCY6)
   04022 cGMP-PKG signaling pathway
    109249043 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109249043 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109249043 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109249043 (ADCY6)
   04062 Chemokine signaling pathway
    109249043 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    109249043 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    109249043 (ADCY6)
   04912 GnRH signaling pathway
    109249043 (ADCY6)
   04913 Ovarian steroidogenesis
    109249043 (ADCY6)
   04915 Estrogen signaling pathway
    109249043 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    109249043 (ADCY6)
   04921 Oxytocin signaling pathway
    109249043 (ADCY6)
   04926 Relaxin signaling pathway
    109249043 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    109249043 (ADCY6)
   04918 Thyroid hormone synthesis
    109249043 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    109249043 (ADCY6)
   04916 Melanogenesis
    109249043 (ADCY6)
   04924 Renin secretion
    109249043 (ADCY6)
   04925 Aldosterone synthesis and secretion
    109249043 (ADCY6)
   04927 Cortisol synthesis and secretion
    109249043 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109249043 (ADCY6)
   04270 Vascular smooth muscle contraction
    109249043 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    109249043 (ADCY6)
   04971 Gastric acid secretion
    109249043 (ADCY6)
   04972 Pancreatic secretion
    109249043 (ADCY6)
   04976 Bile secretion
    109249043 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109249043 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109249043 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    109249043 (ADCY6)
   04727 GABAergic synapse
    109249043 (ADCY6)
   04725 Cholinergic synapse
    109249043 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    109249043 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    109249043 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    109249043 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    109249043 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    109249043 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109249043 (ADCY6)
   04714 Thermogenesis
    109249043 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109249043 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    109249043 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109249043 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109249043 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109249043 (ADCY6)
   05163 Human cytomegalovirus infection
    109249043 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109249043 (ADCY6)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109249043 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA TBK1_ULD Shisa
Motif
Other DBs
NCBI-GeneID: 109249043
NCBI-ProteinID: XP_019274750
Ensembl: ENSPPRG00000002220
Position
Unknown
AA seq 1267 aa AA seqDB search
MPVPAMCWCGACPGAREWTFQFLPDLLCLLTQALELVTTKKSVLFREEVNVEVYCFGVRQ
IWVRILVPTPPWLLDVGRVTRLLLSQFPHLLNGDPVVLLHTFIMSWFSGLLVPKVDERKT
AWGERNGQKRPRRGTRTSGFCTPRYMSCLRDAQPPSPTPAAPPRCPWQDETFMRRGGPGK
EPGLRAVALGFEDTEAMAAVGAAEVAPDVAARGRRSCWRRLAQVFQSKQFRSAKLERLYQ
RYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVALMVVCNRH
SFRQDSMWVVSYVVLGILAAVQVGGALAANPRSPSVGLWCPVFFVYITYTLLPIRMRAAV
FSGLGLSTLHLILAWQLNHGDAFLWKQLGANMLLFLCTNVIGICTHYPAEVSQRQAFQET
RGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSIL
FADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARA
DHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTL
ANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKRKE
EKAMLAKLQRTRANSMEGLMPRWVPERAFSRTKDSKAFRQMGIDDSSKDNRGAQDALNPE
DEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFC
FICFIQLLVFPHSTLLLGIYASIFLLLLITVLTCAVYSCGSLFPKALQRLSRSIVRSRAH
STAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNVTPADITACHLQQLNYSLGLDAP
LCEGTAPTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATI
FDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALYLHAQQVESTAR
LDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVM
FASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAAS
GLNASTYDQAGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARK
PQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYF
LNGGPPS
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgccggctatgtgctggtgtggtgcctgccccggtgctcgggagtggactttt
cagttcctcccagacctcctttgcttactgacacaggcactcgagcttgtaaccaccaag
aaatcagtgctttttagggaagaggtgaatgttgaagtgtactgctttggagtccggcag
atctgggttagaatcttggtgcccacacctccgtggctgcttgatgtagggcgagttacc
cgcctgcttctgtctcagtttcctcacctgctgaatggggatcccgtcgtcctcctccat
acttttatcatgtcctggtttagtggcctcctggtccccaaggtggatgaacggaaaaca
gcctggggtgaacgcaatgggcagaagcgtccacgccgtgggactcggaccagcggcttc
tgcacaccgcgctatatgagctgcctccgggatgcacagccccccagccccacccctgca
gctcctcctcggtgcccctggcaggatgagactttcatgcggagaggtggcccaggcaag
gagccggggctgcgggcggtggccctcggctttgaggacactgaggcgatggcggcggtc
ggggcagccgaggtggcacccgacgtggcagcccggggtaggcggtcttgctggcgccgt
ctggcccaggtgttccagtccaagcagttccgctcggccaagttggagcgcctgtaccag
cggtacttctttcagatgaaccagagcagcctgacgctgctgatggccgtgctggtgctg
ctgacggctgtgctgctagcctttcatgccgcacctgcccgccctcagcctgcctatgtg
gccctactggcctgtgccgccgccctcttcgtagcgctcatggtggtgtgtaaccggcac
agcttccgccaggactccatgtgggtggtgagctatgtggtgctgggcatcctggcagcc
gtgcaggttgggggtgccctggcagccaacccccgcagcccctctgtgggcctctggtgc
cccgtgttttttgtctacatcacctacacgctcctacccatccgcatgcgggcggctgtc
ttcagtggcctgggcctctccaccctgcatctgatcttggcctggcagctcaaccatggt
gatgccttcctctggaagcagcttggtgccaacatgctgctgttcctctgcaccaacgtc
attggcatctgcacacactatccagctgaggtgtctcagcgccaggcctttcaggagacc
cgtggttacatccaggcccggctgcacctgcagcatgagaatcggcagcaggaacggctg
ctgctatcagtattgccccagcacgttgccatggagatgaaagaagatatcaacacaaag
aaagaagacatgatgttccacaagatctacatccagaagcatgacaatgtcagcatcctg
tttgcagacattgaaggcttcaccagcctggcatcccagtgcactgcgcaggagctggtc
atgaccctgaatgagctctttgcccggtttgacaaactggctgcggaaaatcattgcctg
aggatcaagatcttaggggactgttactactgtgtgtcggggctgccggaagcccgagca
gaccatgcccactgctgtgtggagatgggggtggacatgatcgaggccatctcgctggtg
cgtgaggtgacaggtgtgaacgtgaacatgcgcgtgggcatccacagcgggcgtgtgcac
tgtggcgtccttggtctgcggaaatggcaattcgatgtgtggtccaatgacgtgactctg
gccaaccacatggaggcggggggccgggccggccgcatccatatcactcgggccacactg
cagtacctgaatggggattatgaggtggagccaggccgtggtggtgagcgtaatgcatac
ctcaaggagcagcatattgagaccttcctcatcctgggagccagccagaaacggaaagag
gagaaggccatgctggccaagctgcagcgtacacgggccaactccatggaaggactgatg
ccacgctgggtgcctgagcgcgccttttcccggaccaaggactccaaggctttccgccag
atgggcattgatgattccagcaaagacaaccggggtgcccaagatgccctgaaccctgag
gatgaggtagatgagttcctgggccgtgccatcgatgcccgcagcatcgatcaactacgg
aaggaccatgtgcgccgcttcctgctcaccttccagagagaggatcttgaaaagaagtac
tcgcggaaggtggacccccgcttcggagcctacgtagcctgtgcgctgttggtcttctgc
ttcatctgctttatccaactcctcgtcttcccacattcaactctgctgcttgggatctat
gccagtatcttcctgctgttgctgatcactgtgctgacctgtgccgtgtactcctgtggc
tctctcttccccaaggccctgcaacgcctttcccgcagcattgtccgttctcgggcacac
agcactgcggttggcatcttttcagtcttgcttgtgttcacctctgccatcgccaacatg
ttcacctgtaaccacacccccatacggacttgtgcagcccggatgctgaatgtaacacct
gctgacatcactgcctgccacctgcagcagctcaattactctctgggcctggatgctccc
ctgtgtgagggcaccgcacccacttgcagcttccctgagtacttcgttgggaacatgctg
ctgagtctcttggccagctctgtcttcctacacatcagtagcatcgggaagttggcaatg
atctttgtcctcgggctcatctatttggtgctgcttctgctgggccccccagccaccatc
tttgacaactatgacctgctgcttggtgtccatggcttggcttcttccaatgagactttc
gacgggctggactgcccagctgcagggagggtggcactcaaatacatgacccccgtgatt
ctgctggtgtttgctctggcgctgtatctgcatgcccagcaggtggaatcaactgctcgt
ctggacttcctctggaaactgcaggcaacaggggagaaggaggagatggaggagctgcag
gcatacaaccgaaggctgctccataacattctgcccaaggacgtggctgcccacttcctg
gcccgggagcgccggaacgatgagctctactatcagtcgtgtgagtgtgtggccgtcatg
tttgcctccattgccaacttttctgagttctatgtggagctggaggcaaacaatgagggc
gtcgagtgcctgcggctgctcaacgaaatcatcgctgactttgatgagatcatcagcgag
gagcggttccggcagctggagaagatcaagacgattggtagcacctacatggctgcctca
gggctgaatgccagcacctatgatcaagcgggccgctcccatatcactgccctggctgac
tatgccatgcggctcatggaacagatgaagcacatcaacgagcactccttcaacaatttc
cagatgaagattgggctgaacatgggcccagtcgtggcaggcgtcattggggctcggaaa
ccacagtatgacatctgggggaacacagtgaatgtctctagccgtatggacagcacgggg
gtccctgaccgaatccaggtgaccacggacttgtaccaggttctagctgccaagggctac
cagctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttc
ctcaatgggggcccccccagttag

KEGG   Panthera pardus (leopard): 109254969Help
Entry
109254969         CDS       T06062                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04020  Calcium signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04727  GABAergic synapse
ppad04742  Taste transduction
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05032  Morphine addiction
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109254969 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109254969 (ADCY4)
   04371 Apelin signaling pathway
    109254969 (ADCY4)
   04020 Calcium signaling pathway
    109254969 (ADCY4)
   04072 Phospholipase D signaling pathway
    109254969 (ADCY4)
   04024 cAMP signaling pathway
    109254969 (ADCY4)
   04022 cGMP-PKG signaling pathway
    109254969 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109254969 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109254969 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109254969 (ADCY4)
   04062 Chemokine signaling pathway
    109254969 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    109254969 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    109254969 (ADCY4)
   04912 GnRH signaling pathway
    109254969 (ADCY4)
   04913 Ovarian steroidogenesis
    109254969 (ADCY4)
   04915 Estrogen signaling pathway
    109254969 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    109254969 (ADCY4)
   04921 Oxytocin signaling pathway
    109254969 (ADCY4)
   04926 Relaxin signaling pathway
    109254969 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    109254969 (ADCY4)
   04918 Thyroid hormone synthesis
    109254969 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    109254969 (ADCY4)
   04916 Melanogenesis
    109254969 (ADCY4)
   04925 Aldosterone synthesis and secretion
    109254969 (ADCY4)
   04927 Cortisol synthesis and secretion
    109254969 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109254969 (ADCY4)
   04270 Vascular smooth muscle contraction
    109254969 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    109254969 (ADCY4)
   04971 Gastric acid secretion
    109254969 (ADCY4)
   04972 Pancreatic secretion
    109254969 (ADCY4)
   04976 Bile secretion
    109254969 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    109254969 (ADCY4)
   04727 GABAergic synapse
    109254969 (ADCY4)
   04725 Cholinergic synapse
    109254969 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    109254969 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    109254969 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    109254969 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    109254969 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    109254969 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109254969 (ADCY4)
   04714 Thermogenesis
    109254969 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109254969 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    109254969 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109254969 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109254969 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109254969 (ADCY4)
   05163 Human cytomegalovirus infection
    109254969 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109254969 (ADCY4)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109254969 (ADCY4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Motif
Other DBs
NCBI-GeneID: 109254969
NCBI-ProteinID: XP_019284830
Ensembl: ENSPPRG00000019543
Position
Unknown
AA seq 1081 aa AA seqDB search
MVQPDTNGKSRCPVSFCYLSLRHISEVAWGGCLFFFSLEAVPHTPHSSLAASTLSSQELA
SDPGFLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWAALLGLGHGFLFTGGLVSA
WDQVSFFLFVIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSKPALLPQLAA
NAVLFLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLA
REMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVL
MLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLR
AATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLA
LLAGAYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSL
LMTRYLESWGAAKPFAHLSHLESPVSTSTPLPEKALASFGPQWSLDRSRTPRGLDDDLDT
GDAKFFQVIEQLNSQKQWRQSKDFNPLTLYFRKKELEKEYRLSALPAFKYYAACTFLVFL
SNFIIQMLVTNRPPALAITYSITFLLFLLLLFVCFSEHLTRCVLKGPKTLHWLPALSGLV
ATRPGLRVALGTATILLVFVMAIPSLFFLPAASNCPFGALNVSSMAFNISWELPGSLPLI
SVPYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLGASCSLFLHSHAWLSDCLIARLYPD
PSDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMEN
LTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGL
ECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHL
GTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASR
MESTGVLGKIQVTEETARVLQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLARTGPPSATL
G
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggttcaacctgatacgaatggcaagtcgaggtgccctgtctccttttgctacttgagt
ttgagacacatttcagaagtggcctgggggggctgcctgttcttcttcagcttggaggcg
gtcccccatactccacactccagtcttgctgcaagcaccctctcctcgcaggagctagct
tcagacccaggcttcctgaccactgtgctgtgcgcgctgggtggcttctcgctgctcctg
ggcctggcttcccgggagcaacgactgcagcgctggacacgtcccctgtcgggcctcgta
tgggcagcgctactcgggctaggccacggcttcctgttcactgggggcctggtgagcgcc
tgggaccaggtgtcctttttcctctttgtcatcttcaccgtgtacgccatgttgcccttg
ggcatgcgggatgccgctgctgcgggccttgcctcatcgctctcccacttgctggtcctg
gggctgtaccttgggcctcagccggactcaaagcctgcgctgctgccacagctggcagcg
aacgcggtgttgttcctgtgcgggaacgtggcgggagcgtatcacaaggcgctgatggag
cgcgcgctgcgcgccacgttccgcgaggcacttagctccctgcactcgcgccggcggctg
gacaccgaaaagaagcaccaggaacaccttctcttgtccatccttcctgcctacttggcc
cgagagatgaaggcagagatcatggcacgactgcaggctggacaggggtcacggccagaa
agcaccaacaacttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtac
gctgacatcgtgggcttcacccggctggccagtgagtgctctcctaaggagttggtgctc
atgctcaacgagctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcgg
atcaagatcctgggagactgttactactgtgtctctgggctaccgctctccctgccagac
cacgccatcaactgcgtgcgcatggggctggacatgtgccgggccatcaggaagctccgg
gcagccactggcgtggacatcaacatgcgtgtgggcgtgcattcgggcagtgtgctctgc
ggagtcattgggctgcagaagtggcagtatgatgtctggtcccatgatgtcacactggcc
aaccacatggaggcgggtggcgtgccaggacgagtacatattacaggggctaccctggcc
ctgctggcaggggcttatgctgtggaggatgcagccatggaacaccgggacccatacctt
cgggagctaggggagcctacctacctagtcatcgatccccgggctgaggaagaggatgag
aagggcactgcaggagggttgctgtcctctcttgagggccccaagatgcgtccgtcactg
ctgatgacccgctacctggagtcctggggcgccgccaagccttttgcccatctgagccac
ctagagagccctgtgtccacttctacccctctcccggagaaggccctggcttcctttggc
ccccagtggagcctggaccggagccgtaccccccgggggctagatgatgacctggacact
ggggacgccaagttcttccaggtcatcgaacagctcaactctcagaaacagtggaggcag
tcaaaggacttcaacccactgacactgtacttcagaaagaaggaactggagaaagagtac
cgactctctgcactccccgccttcaaatactatgcagcctgcaccttcctggttttcctt
tccaatttcatcatccagatgctggtgacaaacaggcccccagctctggccatcacctat
agcatcaccttcctcctcttcctcctcctcctcttcgtctgcttctcagagcacctgacg
aggtgtgtcttgaaaggccccaagacgctgcactggctgccggcactgtctggcttggtg
gccacacggcccggactgcgagttgcccttggcacagctaccatcctcctggtttttgtg
atggccattcccagcctgttcttcttaccagcagcatcaaactgcccttttggggctctc
aatgtgtcctccatggctttcaacatctcctgggagctccctgggtccctgcctctcatc
agcgtcccttactctatgcactgctgcgtgctggggttcctgtcctgctccctctttttg
cacatgagcttcgagctgaagttgctgctgctcctgctatggctgggggcctcctgctcc
ctcttcctgcactcccacgcctggctgtccgactgcctcatcgcccgcctctatccggat
ccctcggactccaggccaggggtgctgaaggagcccaaactgatgggagctatctccttc
ttcatcttcttcttcaccctccttgtcctggctcggcagaatgagtattactgccggctg
gacttcctgtggaagaagaagctgcggcaggagcaggaggagacagagaccatggagaac
ctgactcggctgctgttggagaatgtgctccctgcacatgtggccccccagttcattggc
cagaaccggcgcaacgaggacctctaccaccagtcctatgagtgtgtctgtgtcctgttc
gcctcagttccagacttcaaggagttttactctgagtccaacataaaccacgagggtcta
gagtgtctgcggctgctcaatgagataattgctgattttgatgagctgctctcaaagccc
aagtttagcggggtggagaagatcaaaaccatcggtagcacctacatggcagctacaggc
ttaaatgccacctccggacaggacgcacagcaggatgctgagcgcagctgcagccacctt
ggcaccatggtggagtttgcggtggctcttggatcaaagctggacgtcatcaataagcac
tctttcaacaacttccgcttgcgtgtggggttgaaccacggacctgtagtggctggagtg
atcggggcccagaagccgcagtatgacatctggggcaacacagtgaacgtggccagccgc
atggagagtacaggagtcctgggcaagatccaggtgactgaagagacagcccgggtgctg
cagtccttaggctacacctgctacagccggggtatcatcaaggtcaaaggcaaagggcaa
ctctgcacctactttctgaacacagatttggcacgaactggacctccctcggccacccta
ggctga

KEGG   Panthera pardus (leopard): 109266493Help
Entry
109266493         CDS       T06062                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5 isoform X1
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04726  Serotonergic synapse
ppad04727  GABAergic synapse
ppad04728  Dopaminergic synapse
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04924  Renin secretion
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05012  Parkinson disease
ppad05030  Cocaine addiction
ppad05031  Amphetamine addiction
ppad05032  Morphine addiction
ppad05034  Alcoholism
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109266493 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109266493 (ADCY5)
   04371 Apelin signaling pathway
    109266493 (ADCY5)
   04072 Phospholipase D signaling pathway
    109266493 (ADCY5)
   04024 cAMP signaling pathway
    109266493 (ADCY5)
   04022 cGMP-PKG signaling pathway
    109266493 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109266493 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109266493 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109266493 (ADCY5)
   04062 Chemokine signaling pathway
    109266493 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    109266493 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    109266493 (ADCY5)
   04912 GnRH signaling pathway
    109266493 (ADCY5)
   04913 Ovarian steroidogenesis
    109266493 (ADCY5)
   04915 Estrogen signaling pathway
    109266493 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    109266493 (ADCY5)
   04921 Oxytocin signaling pathway
    109266493 (ADCY5)
   04926 Relaxin signaling pathway
    109266493 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    109266493 (ADCY5)
   04918 Thyroid hormone synthesis
    109266493 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    109266493 (ADCY5)
   04916 Melanogenesis
    109266493 (ADCY5)
   04924 Renin secretion
    109266493 (ADCY5)
   04925 Aldosterone synthesis and secretion
    109266493 (ADCY5)
   04927 Cortisol synthesis and secretion
    109266493 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109266493 (ADCY5)
   04270 Vascular smooth muscle contraction
    109266493 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    109266493 (ADCY5)
   04971 Gastric acid secretion
    109266493 (ADCY5)
   04972 Pancreatic secretion
    109266493 (ADCY5)
   04976 Bile secretion
    109266493 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    109266493 (ADCY5)
   04727 GABAergic synapse
    109266493 (ADCY5)
   04725 Cholinergic synapse
    109266493 (ADCY5)
   04728 Dopaminergic synapse
    109266493 (ADCY5)
   04726 Serotonergic synapse
    109266493 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    109266493 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109266493 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    109266493 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    109266493 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109266493 (ADCY5)
   04714 Thermogenesis
    109266493 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109266493 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109266493 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    109266493 (ADCY5)
   05031 Amphetamine addiction
    109266493 (ADCY5)
   05032 Morphine addiction
    109266493 (ADCY5)
   05034 Alcoholism
    109266493 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109266493 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109266493 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109266493 (ADCY5)
   05163 Human cytomegalovirus infection
    109266493 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109266493 (ADCY5)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109266493 (ADCY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD PEN-2
Motif
Other DBs
NCBI-GeneID: 109266493
NCBI-ProteinID: XP_019304143
Ensembl: ENSPPRG00000012783
Position
Unknown
AA seq 1263 aa AA seqDB search
MSGSKSVSPPGYAAQTAAAPASRGGPEHRSAWGEADSRANGYPHAPGGSTRSCTKKPGGA
VTPQQQQQQRLANRWRNDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQ
RRGAAGGGSTRAPPGGGGGGSAAAAAAAGGTEVRPRSVELGLEERRGKGRAADELEAGAG
AVEGDEGSGDGSSSAGSGAGPGSVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLN
QSSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDHM
GLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLS
ALHLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQAR
LHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGF
TSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCV
EMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAG
GKAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAK
MNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDE
FLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFV
QITIVPHSVFMLSFYLTCFLLLTLVVFVSVIYSCVKLFPAPLQTLSRKIVRSKTNSTLVG
VFTITLVFLSAFVNMFMCNSKDLFGCLADEHNISTSQVNACHVVESAVNYSLGDERGFCS
SPRPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELTYVLIVEVPRVTLFDNA
DLLVTANAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLW
KLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIA
NFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDS
TYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDI
WGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGP
PLS
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtaagccccccgggctacgcggcgcagacagcggcggcgccg
gcgtcccggggaggcccggaacatcgctcggcgtggggggaggccgattcccgcgccaat
ggctacccccacgcccccgggggttcgacccgcagctgcaccaagaaacccgggggggcg
gtgaccccgcagcagcagcagcagcagcgcctggctaatcgttggcgcaacgacgacgac
gacgatcctccgctgagtggtgacgaccctctggccgggggcttcggcttcagcttccgc
tccaaatctgcttggcaggagcgcggcggcgacgactgcggtcgcggcagccgccggcag
cggcggggcgcggccggcgggggcagcacccgggcgccccctgggggcggcggtggcggc
tcggccgcggctgcggccgcagcgggcgggaccgaggtgcgccctcgctcggtggagctg
ggcctggaggagcggcgaggcaagggccgcgcggcggacgagctggaggccggtgccggt
gccgtcgagggcgacgaagggtcaggggatggcagcagctcggccggctcaggcgcgggg
cccggctcagtgctgtcgctgggcgcctgctgcctggcgctgctgcagatattccgctcc
aagaagttcccgtcggacaaactggagcggctgtaccagcgttacttctttcgtctgaac
cagagcagcctcactatgcttatggccgtgctggtgctcgtgtgcctcgtcatgttggcc
ttccacgcggcgcggcccccgctccagctgccctacctggcagtgctggcggccgcggtg
ggtgtcatccttgtcatggctgtgctctgtaaccgcgccgccttccaccaggaccacatg
ggcctggcctgctacgcgctcatcgccgtggtgctggctgtccaggtggtgggcctgctg
ctgccccagccgcgcagcgcctcggagggcatctggtggaccgtgttcttcatctacacc
atctacacgttgctgcctgtgcgcatgcgggccgcggtactcagtggggtgctgctgtct
gccctccacctggccatcgccctgcgcaccaacgcccaggaccagttcctgctcaagcag
cttgtctccaatgtcctcattttctcctgcaccaacatcgtgggtgtctgcacccactac
ccggctgaggtctctcagagacaggccttccaggaaacccgggagtgcatccaggcacgg
ctccactcacaacgggagaaccagcaacaggagcggctcctactgtctgtcctgccccgt
catgttgccatggagatgaaagcagacatcaatgccaagcaggaggatatgatgttccat
aagatttacatccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggcttc
accagcctggcgtcccagtgcactgcccaggagctagtcatgaccctcaacgagctcttc
gcccgcttcgacaagctggctgcggagaatcactgtttacgtattaagatcctgggggat
tgttattactgtgtctctgggctgcctgaagcgagggctgaccacgctcactgctgcgtg
gagatgggcatggacatgattgaggccatctcgttggtccgggaggtgactggggtgaac
gtgaacatgcgcgtgggaattcacagcgggcgagtacactgcggtgtccttggtctcagg
aagtggcagttcgacgtctggtctaatgacgtcacgctggccaaccacatggaagctgga
ggcaaggcagggcgcatccacatcaccaaggccacgctcaactacctgaatggtgactat
gaggtggagccaggctgtgggggcgagcgcaacgcctacctcaaggagcacagcattgag
accttcctcatcctgcgctgcacccagaagcggaaagaagaaaaggccatgatcgccaag
atgaatcgccagagaaccaactccattgggcacaacccgccccactggggggctgagcgt
cccttctacaaccacctagggggcaaccaggtgtccaaggagatgaagcggatgggcttt
gaagaccccaaggacaagaacgcccaggaaagtgcaaaccccgaggatgaagtggacgaa
tttctgggccgtgccattgacgccaggagcattgacaggctgcggtctgagcatgtccgc
aagttcctcttgaccttcagggagcctgacttagagaagaagtactccaagcaggtggat
gaccgattcggtgcctatgtggcatgtgcctcgcttgtcttcctcttcatctgctttgtc
cagatcaccatcgtgccccactccgtgttcatgttgagtttctacctgacctgtttcctg
ctgctgaccttggtggtgtttgtgtccgtgatttattcctgcgtgaagctcttcccggcc
ccgctgcagaccctttccaggaagatcgtgcggtccaagacgaacagcaccctggtcgga
gtgttcaccatcaccctggtgttcctgtcggcttttgtcaacatgttcatgtgtaactcc
aaggacctgttcggctgcctggcggatgagcacaacatcagcaccagccaggtgaacgcg
tgccatgtggtggagtcggcagtcaactacagcctgggtgacgagcggggcttctgcagc
agcccccggcccaactgcaacttccccgagtacttcacctacagcgtgctgctcagcctg
ctggcctgctccgtgttcctgcagatcagctgcattgggaagctggtgctcatgctggcc
attgagctcacatacgtgctcattgttgaggtgccccgcgtcacgctctttgacaacgcc
gacctgctggtcaccgccaatgccatagacttcagcaacaacgggacctcccagtgccct
gaacatgcgaccaaggtggcgctgaaggtggtgacgcccatcatcatctcagtcttcgtg
ctggccctatacctgcatgcccagcaagtggagtccaccgcccgcctggacttcctctgg
aaactgcaggccacagaggaaaaggaggagatggaggagctgcaggcctacaaccggcgg
ctgctgcacaacatcctgcccaaggatgtggccgcccacttcctggcccgtgagcgacgc
aatgatgagctctactaccagtcgtgtgagtgtgtggccgtcatgttcgcctccatcgcc
aacttctctgaattctacgtggagctggaggccaacaatgagggtgttgagtgcctgcga
ctactcaatgagatcatcgccgactttgacgagatcatcagtgaggatcggttcaggcag
ctggaaaagatcaagaccattggcagcacctacatggctgcctcaggcctcaatgactct
acatatgacaaggtgggcaagacccacatcaaagccctggctgactttgccatgaagctc
atggaccaaatgaagtacatcaatgagcactccttcaacaacttccagatgaagatcggg
ctcaatattggccccgtggtggctggggtgatcggggctcgcaagcctcagtacgacatc
tggggcaatacggtgaacgtggccagccgcatggacagcaccggtgtgcctgaccgcatc
caggtcaccacagacatgtaccaggtgctggctgccaacacataccagctggagtgcagg
ggtgtggtcaaggtcaagggcaaaggagagatgatgacctacttcctcaacggtgggccc
ccgctcagttag

KEGG   Panthera pardus (leopard): 109267527Help
Entry
109267527         CDS       T06062                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04020  Calcium signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04727  GABAergic synapse
ppad04740  Olfactory transduction
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04962  Vasopressin-regulated water reabsorption
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05032  Morphine addiction
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109267527 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109267527 (ADCY3)
   04371 Apelin signaling pathway
    109267527 (ADCY3)
   04020 Calcium signaling pathway
    109267527 (ADCY3)
   04072 Phospholipase D signaling pathway
    109267527 (ADCY3)
   04024 cAMP signaling pathway
    109267527 (ADCY3)
   04022 cGMP-PKG signaling pathway
    109267527 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109267527 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109267527 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109267527 (ADCY3)
   04062 Chemokine signaling pathway
    109267527 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    109267527 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    109267527 (ADCY3)
   04912 GnRH signaling pathway
    109267527 (ADCY3)
   04913 Ovarian steroidogenesis
    109267527 (ADCY3)
   04915 Estrogen signaling pathway
    109267527 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    109267527 (ADCY3)
   04921 Oxytocin signaling pathway
    109267527 (ADCY3)
   04926 Relaxin signaling pathway
    109267527 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    109267527 (ADCY3)
   04918 Thyroid hormone synthesis
    109267527 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    109267527 (ADCY3)
   04916 Melanogenesis
    109267527 (ADCY3)
   04925 Aldosterone synthesis and secretion
    109267527 (ADCY3)
   04927 Cortisol synthesis and secretion
    109267527 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109267527 (ADCY3)
   04270 Vascular smooth muscle contraction
    109267527 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    109267527 (ADCY3)
   04971 Gastric acid secretion
    109267527 (ADCY3)
   04972 Pancreatic secretion
    109267527 (ADCY3)
   04976 Bile secretion
    109267527 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109267527 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    109267527 (ADCY3)
   04727 GABAergic synapse
    109267527 (ADCY3)
   04725 Cholinergic synapse
    109267527 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    109267527 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    109267527 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    109267527 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    109267527 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    109267527 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109267527 (ADCY3)
   04714 Thermogenesis
    109267527 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109267527 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    109267527 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109267527 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109267527 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109267527 (ADCY3)
   05163 Human cytomegalovirus infection
    109267527 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109267527 (ADCY3)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109267527 (ADCY3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N fn3_4
Motif
Other DBs
NCBI-GeneID: 109267527
NCBI-ProteinID: XP_019305893
Ensembl: ENSPPRG00000022933
Position
Unknown
AA seq 1152 aa AA seqDB search
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVYSSDKLAPLVVAGMGLLLDIL
LFVLCKKGLLPDRVTRKVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQTFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGRHLLREILANVCLYLCAIMVG
VMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCE
YLDEKGIETYLIIASKPEVKKTAAQHGLDGPALLNGAPASSKPSSPALIETKEPNGSIHT
SGSTSEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YMTFVVGEVLLLILTVCSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYHTGPVNSTAGTEAEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVTGAVAVINIYAWRPIFDEYDRKRFQEHDFPVVALEKMQVLSTPGLNSTDRLPLVPSK
YSMTVMIFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFANSNKEEKSDRERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVCPARAEHVLRPRDRAQSQNRGCFATCYCLLSVGPGYRVGVFGRLKARVERDASV
EGKKYFDPISKI
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggaaccagggcttttccgagcccgagtactcggctgagtactccgccgaatac
tcggtcagcctgccctctgaccccgaccgcggggtgggccggacccatgaaatctctgtc
cggaactcgggatcctgcctctgcctgcctcgattcatgcggctgacctttgtgcccgag
tccttggagaacttgtaccagacctacttcaaacggcagcgccatgagacgctgctggtg
ctggtggtctttgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtctac
tccagcgacaagctggctcccctggtcgtcgctgggatgggactgctgttggacatcctc
ctgttcgtgctctgcaaaaaggggctgctccccgaccgcgtcacccggaaagtggtgccc
tacctgctgtggctgctgataactgcccagattttctcctacctgggcctgaactttgcc
cgcgcgcatgcggccagcgacacggtgggctggcagaccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtcatcatctccgtggtctcctgtgttgtg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggatgggctgaaaggcagg
cacttgctgagggagatcctggccaacgtctgcctctacctgtgcgccatcatggtgggc
gtcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaaaatgaacctcgaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcatgtggctgacgagatgctaaaggacatgaagaaggacgagagc
caaaaggaccagcagcagttcaacaccatgtacatgtatcgccacgagaacgtcagcatc
ctctttgcggacatcgtgggcttcacccagctgtcttccgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctcttcgcccgctttgacaagctggcggccaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgcggcctgcccgactaccgg
gaggaccacgccgtctgctccatccttatggggctcgccatggtggaggccatctcgtac
gtgcgggagaagacgaagactggggtggacatgcgtgtgggggtgcacacaggcacggtg
ctggggggcgtcctgggccagaagcgctggcagtatgacgtgtggtccaccgacgtcact
gtggccaacaagatggaggccggtggcatccccgggcgtgtgcacatctcccagagcacc
atggactgcctaaagggcgagttcgatgtggagccgggcgacgggggcagccgctgtgag
tacctggacgagaagggcatcgagacctacctcatcatcgcgtccaagccagaggtgaag
aaaacagccgcccagcacggcctcgacggcccggccctgctgaatggagcgccagcttcc
tcaaagcccagctctcccgccctcattgagaccaaggagcccaacggaagcatccacacc
agcggctccacgtcggaggagcccgaggagcaggatgcccaggcggacaacccctcgttc
cccaacccgcgccggaggctgcgccttcaggacctggctgatcgagtggtggacgcctct
gaggacgagcatgagctcaaccagctactcaatgaggccctgcttgagcgagagtccgcc
caggtagtgaagaagagaaacaccttcctcctttccatgcggttcatggaccccgagatg
gaaacccgctactccgtggagaaggaaaagcagagtggggccgcctttagctgctcctgt
gttgtcctgctctgtacggccctggtcgagatactcatcgacccctggctgatgacaaac
tacatgacctttgtggtcggggaggttctccttctgatcctgacggtctgctcgctggcc
gccatctttccccgggcctttcctaagaagctcgtggccttctcgacttggatcgaccgg
acccgctgggccagaaacacctgggccatgttagccatcttcattctggttatggcaaac
gttgtggacatgcttagctgcctgcagtaccacacaggccccgtcaacagcaccgcaggg
acggaggcagaggatggctgcgtagagaaccccaagtattacaactatgtcgctgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgcttgtcacgggtgctgtggctgtcatcaacatctacgcctggcgccccatctttgat
gaatatgaccgcaaacgtttccaggaacatgactttcctgtggtcgccttagagaagatg
caggtactttccacccccgggctcaacagcactgaccggctgcccctggtgccttctaag
tactccatgacagtgatgatcttcatcatgatgctgagcttttactacttctcgcgccac
gtggaaaaattggcacggacactgttcttgtggaagattgaggtccatgaccagaaggaa
cgcgtctacgagatgcggcgctggaatgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagtcatgtttgcctccctgcccaacttcgccgacttctacacagaggag
agcatcaataacggtggcatcgagtgtctgcgcttcctcaacgagatcatctcagatttt
gattctctcctggataatcctaagttccgggtcatcaccaagatcaaaaccatcggcagc
acctatatggcagcttcaggagtcaccccggatgtcaacaccaatggcttcgccaactcc
aacaaggaggaaaagtctgaccgggagcgctggcaacacctggctgacctggctgacttc
gctctggccatgaaggacacactcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaacca
cattatgacatctggggcaatacggtgaacgtagccagcaggatggagtccacaggggtc
atgggtaacattcaggtatgtccagcgagagccgagcatgtgctcagacccagggaccgg
gcacaaagtcagaatagggggtgctttgccacatgctactgcctcctttctgttggccca
ggttatcgagttggtgtttttggaagattaaaggcaagggtggaaagggatgcctcagta
gaagggaagaaatacttcgaccccatttccaaaatttag

KEGG   Panthera pardus (leopard): 109267830Help
Entry
109267830         CDS       T06062                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2 isoform X1
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04020  Calcium signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04727  GABAergic synapse
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04922  Glucagon signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05032  Morphine addiction
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109267830 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109267830 (ADCY2)
   04371 Apelin signaling pathway
    109267830 (ADCY2)
   04020 Calcium signaling pathway
    109267830 (ADCY2)
   04072 Phospholipase D signaling pathway
    109267830 (ADCY2)
   04024 cAMP signaling pathway
    109267830 (ADCY2)
   04022 cGMP-PKG signaling pathway
    109267830 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109267830 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109267830 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109267830 (ADCY2)
   04062 Chemokine signaling pathway
    109267830 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    109267830 (ADCY2)
   04922 Glucagon signaling pathway
    109267830 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    109267830 (ADCY2)
   04912 GnRH signaling pathway
    109267830 (ADCY2)
   04913 Ovarian steroidogenesis
    109267830 (ADCY2)
   04915 Estrogen signaling pathway
    109267830 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    109267830 (ADCY2)
   04921 Oxytocin signaling pathway
    109267830 (ADCY2)
   04926 Relaxin signaling pathway
    109267830 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    109267830 (ADCY2)
   04918 Thyroid hormone synthesis
    109267830 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    109267830 (ADCY2)
   04916 Melanogenesis
    109267830 (ADCY2)
   04925 Aldosterone synthesis and secretion
    109267830 (ADCY2)
   04927 Cortisol synthesis and secretion
    109267830 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109267830 (ADCY2)
   04270 Vascular smooth muscle contraction
    109267830 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    109267830 (ADCY2)
   04971 Gastric acid secretion
    109267830 (ADCY2)
   04972 Pancreatic secretion
    109267830 (ADCY2)
   04976 Bile secretion
    109267830 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    109267830 (ADCY2)
   04727 GABAergic synapse
    109267830 (ADCY2)
   04725 Cholinergic synapse
    109267830 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    109267830 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109267830 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    109267830 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    109267830 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109267830 (ADCY2)
   04714 Thermogenesis
    109267830 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109267830 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    109267830 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109267830 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109267830 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109267830 (ADCY2)
   05163 Human cytomegalovirus infection
    109267830 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109267830 (ADCY2)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109267830 (ADCY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Motif
Other DBs
NCBI-GeneID: 109267830
NCBI-ProteinID: XP_019306359
Ensembl: ENSPPRG00000003380
Position
Unknown
AA seq 1097 aa AA seqDB search
MWREAMRRRRYLRDRAEAAAAAAAAAAGGGDGLQRSRDWLYESYYCMSQQHPLIVFLLLI
VMGACLALLAVFFALRLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVI
WMCLVAMGYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTASSHTVVL
SICLSATPGAKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKL
EFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILY
ADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPN
HAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLA
NHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSP
HLFRPRHTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHN
FQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEKEYRA
TALPAFKYYVTCACLILFCIFVVQILVLPKTSILGISFGAAFLLLACILFVCFAGQLLQC
SKKASASLLWLLKSSSIIADRPWPRVSLTVLTTAIILTMAVFNMFFLSDPEEAMPPPANT
SNTSLSALNNQAVILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMAALIGYN
TILLHTHAHVLDDYSQVLFERPGIWKDLKTMGSVSLFIFFITLLVLGRQNEYYCRLDFLW
KNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIP
DFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAV
PSQEHTQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQ
KPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGELKTY
FVNTEMSRSLSQSNVAS
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgggaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggcggcggct
gcggcggcggcggcggcggcgggcggcggcgacgggctgcagcggtcccgggactggctg
tacgagtcctactactgcatgagccagcagcacccgctcatcgtcttcctgctgctcatc
gtcatgggcgcctgcctcgccctgctcgccgtcttcttcgcgctccggctggaagtcgaa
gaccatgtggcgtttttaataacagtcccaactgccctggcgatcttctttgcgatattc
atcctcgtgtgcatcgagtccgtgtttaagaagctgctacgccttttctctttggtgata
tggatgtgtctggtggccatggggtacttgttcatgtgctttggaggcaccgtctccccc
tgggaccaggtgtccttcttcctcttcattatcttcgtggtatacaccatgctccccttc
aacatgcgagacgccatcatcgccagcgtgctcacggcctcctcccacaccgtcgtgctg
agcatctgcctgtccgcaacgcccggggccaaggagcacctggtctggcagatcctggcc
aacgtgatcattttcatctgtgggaacctggcgggagcgtaccacaagcacctcatggaa
cttgctctgcagcagacgtaccaggacacgtgcaattgcatcaagtcccggatcaagctg
gaatttgaaaagcgtcagcaggagcgtctcctgctgtctctgttgccggctcacatagcc
atggagatgaaagctgagatcatccagaggctgcagggccccaaagccggccaaatggaa
aacacaaacaactttcacaacctgtatgtcaagcgacataccaatgtgagtatcctgtac
gcagacatcgttggcttcacccggttggccagtgactgctcgccaggagaactggtccac
atgctgaacgagctctttggaaagttcgatcaaattgcaaaggagaatgagtgcatgaga
ataaaaattttgggagactgctactactgcgtgtccggactccccatatctctcccgaac
catgccaagaattgtgtgaaaatgggactggatatgtgtgaagccataaagaaagtgagg
gatgccaccggcgtggatatcaacatgcgcgtcggagtgcattctgggaacgtcctctgc
ggcgtgatcggtctgcagaagtggcagtatgacgtgtggtcacatgacgttaccttagcc
aatcacatggaagccggaggggttcctggacgtgttcacatttcttctgtcaccttggaa
cacttgaatggtgcttataaagtggaggaaggagatggtgacatcagagacccatattta
aaacagcacctggtgaaaacctactttgtaatcaaccccaagggggaacgacggagtcct
cacctcttcagacctcgccacaccctcgatggagccaagatgagggcttccgtccgcatg
acccggtacctggagtcctggggagcagccaagccctttgcacacctgcatcaccgagat
agcatgaccacggagaacggcaagatcagcaccacggatgtgccaatgggtcagcataat
tttcaaaaccgtaccttaagaaccaagtcgcaaaagaagagatttgaggaagagttaaat
gaaaggatgattcaagcaattgatggaattaatgcacaaaagcagtggctcaagtctgaa
gacattcagagaatctcgctcctgttctacaataaaatactagaaaaagaataccgagcc
accgcactgccagcgttcaagtattacgtgacctgcgcgtgtctcatattgttctgcatt
tttgtcgtgcagattctggtattacccaagacgtccattcttgggatctcctttggagcc
gcgtttctcttgcttgcctgtatccttttcgtctgctttgctggacagcttttgcaatgc
agcaagaaggcctccgcctctctcctgtggctgctgaagtcatccagcatcatcgcggac
cggccctggccgcgggtctccctcacggtcctcaccaccgccatcatcctgaccatggcc
gtgttcaacatgtttttcctgagcgacccagaggaagccatgcctccgcctgccaacaca
tcaaacacgagtctttctgccttaaacaatcaggcagtgattctgcgagcacagaatttg
tttttcctcccgtactttatctacagctgcattctgggactgatttcctgctcggttttc
ctgcgggtgaattacgagttgaaaatgctgatcatgatggcggcgttgataggctacaac
accatccttctccacactcacgcccacgtcctggacgactacagccaggtcttatttgag
agaccaggcatttggaaagatctgaagaccatgggctcagtgtctctctttatatttttc
atcacactgcttgttctgggtagacagaatgaatattactgtaggttagacttcttgtgg
aagaacaagttcaaaaaagagcgggaggagatagaaaccatggagaacttgaaccgcgtg
ctgctggagaacgtgctgcccgcgcacgtggccgaacatttcctggcccggagcctgaag
aacgaggagttgtaccaccagtcctacgactgtgtctgtgtcatgtttgcttccattccg
gatttcaaggaattctacacagaatcggatgtgaacaaggagggcttggaatgccttcgg
ctcctgaacgagatcatcgccgactttgatgatctgctgtccaagccgaaattcagtgga
gttgaaaagatcaagaccatcggcagcacgtatatggccgcgaccggtctgagcgccgtg
cccagccaggagcatacccaggagcccgagaggcagtacatgcatatcggcaccatggtg
gagtttgcctttgccctggtggggaagctggacgctatcaacaaacactccttcaacgac
ttcaagctgcgagtgggtattaaccatgggcctgtaatagccggtgtgattggagctcag
aagccacaatacgatatctggggcaacaccgtgaatgtggccagcaggatggacagcacc
ggcgtgctggacaaaatacaggtcactgaggagacaagcctcatcctccagaccctgggg
tacacgtgcacgtgtcgaggaataatcaacgtgaaaggcaagggggagctgaagacgtac
tttgtaaacacggaaatgtcaaggtccctttcccagagcaacgtggcatcctga

KEGG   Panthera pardus (leopard): 109267948Help
Entry
109267948         CDS       T06062                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04020  Calcium signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04720  Long-term potentiation
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04727  GABAergic synapse
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05032  Morphine addiction
ppad05142  Chagas disease (American trypanosomiasis)
ppad05146  Amoebiasis
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109267948 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109267948 (ADCY1)
   04371 Apelin signaling pathway
    109267948 (ADCY1)
   04020 Calcium signaling pathway
    109267948 (ADCY1)
   04072 Phospholipase D signaling pathway
    109267948 (ADCY1)
   04024 cAMP signaling pathway
    109267948 (ADCY1)
   04022 cGMP-PKG signaling pathway
    109267948 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109267948 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109267948 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109267948 (ADCY1)
   04062 Chemokine signaling pathway
    109267948 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    109267948 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    109267948 (ADCY1)
   04912 GnRH signaling pathway
    109267948 (ADCY1)
   04913 Ovarian steroidogenesis
    109267948 (ADCY1)
   04915 Estrogen signaling pathway
    109267948 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    109267948 (ADCY1)
   04921 Oxytocin signaling pathway
    109267948 (ADCY1)
   04926 Relaxin signaling pathway
    109267948 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    109267948 (ADCY1)
   04918 Thyroid hormone synthesis
    109267948 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    109267948 (ADCY1)
   04916 Melanogenesis
    109267948 (ADCY1)
   04925 Aldosterone synthesis and secretion
    109267948 (ADCY1)
   04927 Cortisol synthesis and secretion
    109267948 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109267948 (ADCY1)
   04270 Vascular smooth muscle contraction
    109267948 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    109267948 (ADCY1)
   04971 Gastric acid secretion
    109267948 (ADCY1)
   04972 Pancreatic secretion
    109267948 (ADCY1)
   04976 Bile secretion
    109267948 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    109267948 (ADCY1)
   04727 GABAergic synapse
    109267948 (ADCY1)
   04725 Cholinergic synapse
    109267948 (ADCY1)
   04720 Long-term potentiation
    109267948 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    109267948 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109267948 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    109267948 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    109267948 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109267948 (ADCY1)
   04714 Thermogenesis
    109267948 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109267948 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    109267948 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109267948 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109267948 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109267948 (ADCY1)
   05163 Human cytomegalovirus infection
    109267948 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109267948 (ADCY1)
   05142 Chagas disease (American trypanosomiasis)
    109267948 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109267948 (ADCY1)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109267948 (ADCY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Motif
Other DBs
NCBI-GeneID: 109267948
NCBI-ProteinID: XP_019306510
Position
Unknown
AA seq 903 aa AA seqDB search
MYGVFVRILAERSQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSF
LKAHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFS
NVLTCEDDDKRRALRTASEKLRNRSSFSANAVYTTPGTRVNRYIGRLLEARQTELEMADL
DFFTLKYKQAERERKYHQLQDEYFTSAVVLALVLAALFGLVYLLIIPQNLVLLLLLAFCI
CFLVACVLYLHVTQVQCFPGCLTIQIRTVLCIFVVVLIYSVAQGCVVGCLPWSWSSTPNG
SLVVLTPSGRNAVLPAAPCESAPHALLCGLVGTLPLAVFLRVSSLPKMILLFVLTTSYIL
VLELSGYTRAPGGGVASGRSFEPIMAILLFSCTLALHARQVDVKLRLDYLWAAQAEEERD
DMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFDDFYIEL
DGNNMGVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTTGTKAKKGI
SSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVN
VASRMDSTGVQGRIQVTEEVHRLLRRGTYRFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQ
ARERKVCGYGRAGLQGRLGTGPPPVSSMAGLPVRAGMGALQGSGLPPCPHGQHLPPGAAG
KEA
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgtatggggtgtttgtgcgcatcctggccgagcgctcccagcggaaagccttcctgcaa
gcccggaactgcatcgaagatcggctgaggctggaggatgagaacgagaagcaggagcgg
ctgctcatgagccttctgccccggaatgttgcgatggagatgaaggaggacttcttgaag
ccccccgagaggattttccacaagatttacatccagcggcatgacaacgtgagcatcctc
tttgcggacattgtgggcttcacgggcctggcgtcgcagtgcacggcacaggagctggtc
aagctcctcaacgagctgttcggcaagtttgatgaactggccacggagaatcactgtcgc
cgcatcaagatcctaggggactgttactactgtgtgtccggcctcacccagcccaagacc
gaccacgcccactgctgcgtggagatgggcctggacatgatcgacaccatcacgtctgtg
gccgaggccaccgaggtggacctgaacatgcgcgtggggctgcacacaggcagggtcctc
tgcggggtcctgggcctgcgcaagtggcagtacgatgtgtggtccaatgacgtgaccctg
gccaacgtcatggaggcggctggcctacctgggaaggtccacatcacgaagacgaccctg
gcgtgcctgaacggggactacgaggtggagccaggtcacggacatgagaggaacagtttt
ctgaaagctcacaacatcgagaccttcttcatcgtgccgtcacatcggcggaagatattt
ccagggctgatcctctctgacataaaaccagccaagaggatgaagttcaagaccgtgtgc
tacctgctcgtgcagctgatgcactgtcggaagatgttcaaagcagagatcccgttctct
aatgtcctgacgtgtgaggacgatgacaagcggagggcgctgagaaccgcgtcggagaaa
ctgcgaaaccgctcgtcgttctccgcaaacgctgtctacaccaccccgggcacgcgcgtc
aacaggtacatcggccgcctcctggaagcacgccagacggagctggagatggcggacctg
gacttcttcactctcaagtacaagcaggctgagcgggagcgcaagtaccaccagctccag
gacgagtattttaccagcgccgtcgttctggccctcgtcctggccgccttgttcggcctc
gtctacctgctcatcatcccacagaacctggtcctcctgctgctgctggccttctgtatc
tgcttcctggtggcctgcgtcctgtacctgcacgtcacccaggtccagtgttttccaggg
tgcctgacgattcagatccgcaccgtcttgtgtatcttcgtcgtggtcttaatctactct
gtggcccaaggatgtgtggtgggctgcctgccctggtcctggagctccacccccaacggg
tccctggtggtcctgacacccagcggccgcaacgccgtgctgcctgccgcgccctgtgag
tcggcgccccacgccctgctctgcggccttgtgggtaccctcccgctggccgtcttcctg
cgggtgtcctccctgcccaaaatgatcctgctctttgtgctcacgacgtcctacatcctg
gtcctggagctcagcggctacaccagggcccccgggggcggcgtggcgtcggggcgcagt
ttcgagccgatcatggccatcctgctgttttcctgcaccctggccctgcacgcccgtcag
gtggacgtcaagctgcggctggactacctctgggcggcacaggcagaggaggagagagac
gacatggagagggtgaagttggacaacaagaggattctcttcaacctcctgccggcccac
gtggctcagcacttcctcatgtccaacccccgcaacatggacctgtactaccagtcctac
tcacaggtgggcgtcatgtttgcttccatccccaacttcgacgacttctacatcgagctg
gacggcaacaacatgggggtggagtgtctgcgtctcctgaacgagatcatcgcagacttc
gacgagctcatggacaaagacttttacaaggacttggagaagatcaagaccatcgggagc
acctacatggccgctgtggggctggcgcctaccactgggaccaaggccaagaagggcatc
tcctcccacctgagcacactggccgacttcgccatcgagatgttcgacgtcctggatgaa
atcaactaccagtcttacaacgactttgtgctccgtgtgggcatcaacgtgggccctgtg
gtggccggggtgattggggctcggaggccgcagtacgacatttgggggaacacggtcaac
gtggccagtcggatggacagcaccggcgtccagggcagaatccaggtgactgaggaggtt
caccggctgctgcgccgggggacctaccgcttcgtgtgccgcgggaaggtcagcgtcaag
ggcaagggtgagatgctaacgtacttcctggaaggcaggacggacggaaacggctcccaa
gccagggagcggaaagtgtgtggctacgggcgagccggcctccagggcagactgggcacg
ggcccgcccccggtgtcctccatggccggcctcccggtcagagctgggatgggggctctg
cagggctcagggctccccccctgcccccatggccagcacctgccccccggagcagctggg
aaggaggcttag

KEGG   Panthera pardus (leopard): 109270953Help
Entry
109270953         CDS       T06062                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04020  Calcium signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04727  GABAergic synapse
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05032  Morphine addiction
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109270953 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109270953 (ADCY7)
   04371 Apelin signaling pathway
    109270953 (ADCY7)
   04020 Calcium signaling pathway
    109270953 (ADCY7)
   04072 Phospholipase D signaling pathway
    109270953 (ADCY7)
   04024 cAMP signaling pathway
    109270953 (ADCY7)
   04022 cGMP-PKG signaling pathway
    109270953 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109270953 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109270953 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109270953 (ADCY7)
   04062 Chemokine signaling pathway
    109270953 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    109270953 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    109270953 (ADCY7)
   04912 GnRH signaling pathway
    109270953 (ADCY7)
   04913 Ovarian steroidogenesis
    109270953 (ADCY7)
   04915 Estrogen signaling pathway
    109270953 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    109270953 (ADCY7)
   04921 Oxytocin signaling pathway
    109270953 (ADCY7)
   04926 Relaxin signaling pathway
    109270953 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    109270953 (ADCY7)
   04918 Thyroid hormone synthesis
    109270953 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    109270953 (ADCY7)
   04916 Melanogenesis
    109270953 (ADCY7)
   04925 Aldosterone synthesis and secretion
    109270953 (ADCY7)
   04927 Cortisol synthesis and secretion
    109270953 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109270953 (ADCY7)
   04270 Vascular smooth muscle contraction
    109270953 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    109270953 (ADCY7)
   04971 Gastric acid secretion
    109270953 (ADCY7)
   04972 Pancreatic secretion
    109270953 (ADCY7)
   04976 Bile secretion
    109270953 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    109270953 (ADCY7)
   04727 GABAergic synapse
    109270953 (ADCY7)
   04725 Cholinergic synapse
    109270953 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    109270953 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109270953 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    109270953 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    109270953 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109270953 (ADCY7)
   04714 Thermogenesis
    109270953 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109270953 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    109270953 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109270953 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109270953 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109270953 (ADCY7)
   05163 Human cytomegalovirus infection
    109270953 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109270953 (ADCY7)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109270953 (ADCY7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Motif
Other DBs
NCBI-GeneID: 109270953
NCBI-ProteinID: XP_019311526
Ensembl: ENSPPRG00000024790
Position
Unknown
AA seq 1081 aa AA seqDB search
MPAKGRYFLNEGEEGPNQDVLYEKYRLTSQHGPLLLTLLLVAVTACVALIVIAFVCGDPS
GHQTVLGTTFFTLAVFVVLYVLVYVECLVRRWLRASALLIWVCLMMLGYVLVFDSWIKTT
HMGAQVPFFLFIVFVVYTLLPFSMQGAVVAGAVSSISHLLVIGALMEAFTTPSVRAGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRVKKRQQENLLLSVLPAH
ISMGMKLAIIERLKERGDRRYMPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPKEL
VVMLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LNHLDKAYEVEDGHGQQRDPHLKEMNIHTYLVIDPRSQQPPPPSQHLPKPKGDVALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSNETPIPNGRRPKAIPLRRHRAPDRSASPKGRS
EDDSYDEEILSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRVRHYFACA
SLVFVCILLVHVLLLPRMAALGVSFGLVACVLGLVLGLCFAHEFLRCCPARGTLQAISER
VETQPLLRLSLAILTIGSLLSIAIVNLPLMPFPALRQPAGNQSLADGDVSSRELAPCKLL
PYYTCSCILAFVACSVFLRMSLELKVVLLTVALVAYLVLFNISPCWQWDCCSHSLANLTK
TNGTLSSSPFCLWKDPKAMINFYLVLFYVTLIMLSRQIDYYCRLDCLWKKKFKKEHEEFE
TMENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNK
EGLECLRLLNEIISDFDELLLKPKFSSVEKIKTIGSTYMAAVGLSVPSGTENQDLERQHA
HIGIMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVA
SRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGSGL
N
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaaggggcgctacttccttaacgagggcgaggagggcccgaaccaggacgtg
ctctacgagaagtaccgtctcaccagccagcacgggccgctgctgctcacgctcctgttg
gtggctgtcactgcctgcgtcgccctcatcgtcatcgccttcgtctgcggggacccctct
ggacaccagactgtcctggggacgaccttcttcacacttgctgtgtttgtggttctctac
gtgctggtttatgttgagtgcctcgtccggcggtggctcagggcctcggcgctgctcatc
tgggtctgccttatgatgctgggctatgtgctggtgttcgactcatggataaagacaacc
cacatgggggcacaggtgcccttcttcctcttcattgtgttcgtggtgtacacgctgctg
cccttcagcatgcagggggccgtcgtggcgggggcagtctccagcatctcccacctcctc
gtgatcggggctctgatggaggccttcacgacgcccagtgtccgtgcagggctgcagctg
ctggccaacgctgtcatcttcctgtgtgggaatctcacgggcgccttccacaagcaccag
atgcaggacgcctcccgagacctcttcacctacaccgtcaagtgcatccagatccgtcgt
aaactgcgcgtcaagaagcgtcagcaggagaacctgctgctgtcggtgctgcccgcccac
atctccatgggcatgaagctggccatcatcgagcggctcaaggagcgcggggaccgccgc
tacatgcccgacaacaacttccacagcctgtacgtcaagcggcaccagaacgtcagcatc
ctctatgcggacatcgtgggcttcacgcggctggccagcgactgctcccccaaagagttg
gtggtgatgctgaacgagctcttcggcaagttcgaccagatcgccaaggccaatgagtgt
atgcggatcaagatcctgggcgactgctattactgtgtgtcgggcctgcccgtatccctg
cccacccatgcccggaactgtgtgaagatggggctggacatgtgtgaggccattaagcag
gtgcgagaggccacaggtgtggacatcagcatgcgtgtgggcatccactcagggaacgtg
ctgtgtggtgtcattgggctgcgcaagtggcagtacgacgtgtggtcccacgacgtgtct
ctggccaacaggatggaggcggctggagtccctggccgggtgcacatcacagaggccacg
ctgaaccacctggacaaggcgtatgaggtggaggacgggcacggacagcagcgggacccc
cacctgaaggagatgaacatccacacctacctggtcatcgacccccggagccagcagccg
cccccgcccagccagcacctccccaagcccaagggggatgtggccctgaagatgcgggcg
tccgtgcgcatgacccgctacctcgagtcctggggggctgcacggccctttgcacacctc
aaccaccgcgagagcgtgagcagcaacgagacccctatccccaacggacggaggcccaag
gccattcccctgcggcgccaccgggcccctgacaggagtgcatcccccaaggggaggtct
gaggacgactcatacgacgaggagatcctctcggccatcgaggggcttagctccacgagg
ccctgctgctccaaatctgatgacttctacacctttgggtccatcttcctggagaagggc
tttgagcgagagtaccgcctggcgcccatcccccgggtccgccactatttcgcctgcgcc
agcctcgtcttcgtctgcatcctgctcgttcacgtcctgctcttgcccaggatggcggcc
ctgggtgtgtccttcgggctggtggcctgtgtgctggggctggtgctgggcctgtgcttt
gcccacgagttcctgaggtgctgccccgcccgagggacactgcaggccatctccgagagg
gtggagacccagcccctgctgcggctgtccctggccatcctgaccattggcagcctgctc
agcatcgccatcgtcaacctgccgctgatgcctttcccggccctgaggcagcctgcaggc
aaccagagcttggcggatggggacgtgagcagcagggagctggccccgtgcaagctcctc
ccgtattacacctgcagctgcatcctggcctttgtcgcctgctccgtcttcctgcggatg
agcctggagctgaaggtggtgctgctgacggtggccctggtggcctacctggtgctcttc
aacatctccccgtgctggcagtgggactgctgcagccacagcctggccaacctcaccaag
accaacggcaccctcagcagctccccgttctgtctgtggaaggacccgaaggcaatgatc
aatttctacctggttttgttttacgtcaccctcatcatgctctccagacagattgactat
tactgccgcttggattgcttgtggaagaagaagttcaaaaaggaacacgaggagtttgaa
accatggagaacgtgaaccgcctccttctggagaacgtcttgccagcccacgtggccgca
cacttcattggtgacaagctaaatgaggactggtaccatcagtcctacgactgtgtgtgt
gtcatgtttgcgtcggtgccggacttcaaagtcttctacacggagtgcgacgtcaacaag
gaggggctggagtgcctgcgtctgctgaacgagatcatctccgacttcgacgagctgctc
ctaaagcccaagttcagcagtgtggagaagatcaagaccattggcagcacgtacatggca
gccgtggggctcagcgtcccctcagggactgagaaccaggacctggagcggcagcacgcg
cacatcggcatcatggtggagttcagcatcgccctgatgagcaagctggacggcatcaac
cggcactccttcaactccttccgcctgcgagtcggcataaaccacgggcctgtgatcgct
ggagtgatcggggcacgaaagcctcagtatgatatctggggaaacacggtcaacgtcgcc
agccgaatggagagcactggagaacttggcaagatccaggttactgaggagacatgcacc
atcctccagggactaggttattcttgcgagtgccggggactgattaacgtcaaaggcaaa
ggcgagctgaggacttactttgtctgcacagacacagcaaagttccaagggtcgggactg
aattga

KEGG   Panthera pardus (leopard): 109273118Help
Entry
109273118         CDS       T06062                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04020  Calcium signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04720  Long-term potentiation
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04727  GABAergic synapse
ppad04742  Taste transduction
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05032  Morphine addiction
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109273118 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109273118 (ADCY8)
   04371 Apelin signaling pathway
    109273118 (ADCY8)
   04020 Calcium signaling pathway
    109273118 (ADCY8)
   04072 Phospholipase D signaling pathway
    109273118 (ADCY8)
   04024 cAMP signaling pathway
    109273118 (ADCY8)
   04022 cGMP-PKG signaling pathway
    109273118 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109273118 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109273118 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109273118 (ADCY8)
   04062 Chemokine signaling pathway
    109273118 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    109273118 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    109273118 (ADCY8)
   04912 GnRH signaling pathway
    109273118 (ADCY8)
   04913 Ovarian steroidogenesis
    109273118 (ADCY8)
   04915 Estrogen signaling pathway
    109273118 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    109273118 (ADCY8)
   04921 Oxytocin signaling pathway
    109273118 (ADCY8)
   04926 Relaxin signaling pathway
    109273118 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    109273118 (ADCY8)
   04918 Thyroid hormone synthesis
    109273118 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    109273118 (ADCY8)
   04916 Melanogenesis
    109273118 (ADCY8)
   04925 Aldosterone synthesis and secretion
    109273118 (ADCY8)
   04927 Cortisol synthesis and secretion
    109273118 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109273118 (ADCY8)
   04270 Vascular smooth muscle contraction
    109273118 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    109273118 (ADCY8)
   04971 Gastric acid secretion
    109273118 (ADCY8)
   04972 Pancreatic secretion
    109273118 (ADCY8)
   04976 Bile secretion
    109273118 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    109273118 (ADCY8)
   04727 GABAergic synapse
    109273118 (ADCY8)
   04725 Cholinergic synapse
    109273118 (ADCY8)
   04720 Long-term potentiation
    109273118 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    109273118 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    109273118 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    109273118 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    109273118 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    109273118 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109273118 (ADCY8)
   04714 Thermogenesis
    109273118 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109273118 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    109273118 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109273118 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109273118 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109273118 (ADCY8)
   05163 Human cytomegalovirus infection
    109273118 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109273118 (ADCY8)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109273118 (ADCY8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Motif
Other DBs
NCBI-GeneID: 109273118
NCBI-ProteinID: XP_019315378
Ensembl: ENSPPRG00000023138
Position
Unknown
AA seq 1252 aa AA seqDB search
MELSDVRCLSGSEELYTIHPTPPAGDGGSGSRPQRLLWQTAVRHITEQRFIHGHRGSGGG
SGSRGSGKASDAAGGGPNHHAAQLSGDSALPLYSLGPGERAHSSGGTKVFPERSGSGSGS
GSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRR
KSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSH
TYLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGT
SLLQVVVQVAIPRLAVISINQVMAQAVLFMCMNTAGTFISYLSDRAQRQAFLETRRCVEA
RLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFAD
VKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHA
HCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANK
LESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLTLPE
DIVKESVSFSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALH
VQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCA
FIVLLFITAIQSLLPSSRVMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWIN
ETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSCPEYFVFT
GVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKE
ASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHV
ARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFD
ELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINK
HSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLI
LKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGL
VQSLNRQRQKQLLNENINTGIIKGHYNRRTLLTASGPEPGAQAEGADKSDLP
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgcctgagcggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcgggagcggctcccggccgcagcggctgctgtggcagacg
gcggtgaggcacatcaccgagcagcgcttcattcacgggcaccggggcagcggcggcggc
agcgggagtaggggctccggcaaagcctcggacgctgcaggcggcggccccaaccaccac
gcggcgcagctgtccggggactcggcgctgcccctctactcgctgggccccggggagaga
gcgcacagctccggtggcaccaaagtcttcccggaacgcagcgggagcggcagcggcagc
ggcagcgggggcgggggcgatctgggcttcctgcacctggactgcgccccgagcaactcg
gatttcttcctcaatgggggctacagctaccgaggggtcattttccccactctgcgcaac
tccttcaagtccagggatctggagcgcctctaccagcgctatttcctgggccagaggcgc
aaatccgaggtggtgatgaacgtgctggacgtgctgaccaaactcaccctcttggtcctc
cacctgagcctggcctcggcccccatggacccgctcaagggcattctcctgggcttcttc
actggcatcgaggtggtgatctgcgcgctcgtggtggtcaggaaggacaccacctcgcac
acgtacctgcagtacagcggcgtggtcacttgggtggccatgaccacccagatcttggca
gcaggcctcggctacgggcttctgggtgatggcatcggctacgtcctcttcacgctgttt
gccacctacagcatgctgccgctgccgctcacctgggccatcctggccggcctgggcacc
tcgctgctgcaggtggtcgtgcaggtggccattcctcggctggcggtcatctccatcaac
caggtgatggcccaggcagtgctgttcatgtgtatgaacacggctggaaccttcatcagt
tacctgtcagaccgggcccagcgccaagccttcctggagacacggaggtgtgtggaggcc
aggctgcgcctggagacggaaaaccaaagacaggagcggctcgtgctgtctgtgcttccc
cggtttgtcgtcctggaaatgatcaatgacatgaccaatgttgaagacgagcacctgcag
caccaattccatcggatctacatccaccgctacgagaatgtcagtattctttttgcagat
gttaaaggatttaccaacctctccacaaccttgtctgcccaggagctggtcaggatgctc
aacgagctctttgccagatttgatcgactggcccacgagcatcactgccttcgcattaaa
atcctgggggactgttactactgtgtttcagggcttccagagccccgccaggaccacgcc
cactgctgcgttgaaatgggcctcagcatgatcaaaaccatcaggtatgtgaggtcaagg
acgaagcatgatgttgacatgcggatcggaatccactcgggctcggtgctgtgtggcgtg
ttgggtctgagaaagtggcagtttgatgtctggtcttgggacgtggacatcgcgaacaaa
cttgagtctggaggaatccctgggaggattcacatttccaaagccacgctggactgcctc
aacggtgactataatgtggaagagggtcatggtaaagagagaaacgaattcttgaggaag
cataacatagagacctatttgattaagcagcctgaggagagcctactgacgttgcccgaa
gacattgtcaaggagtcggtgagcttctcagacaggagaaacagtggggcgacattcaca
gaaggatcctggagccccgaactgccctttgataacatagtggggaaacagaacactctg
gctgccctaacaagaaattcaataaatctacttccaaaccatcttgcacaagctttgcat
gtccagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagt
ggcgataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagc
ctggagcacaagtattctcaaatgagggatgaagtattcaagtcaaacttggtctgtgca
tttatcgttctcctatttatcacggcaatacaaagtttgcttccttcttcaagggtgatg
ccaatggccatccagttttccatcctgatcatgctgcactcggctctggtcctcatcacc
acggcagaagattacaagtgtttgcctctcgtcctccggaaaacttgctgttggattaac
gagacctacttagcccggaacgtcatcatctttgcatccatcttgattaacttcctgggc
gccatcttgaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgact
ttcaattcctcagctgtgtttacagatatctgctcctgcccagagtacttcgtcttcact
ggggtgttggccatggtgacctgtgcggttttcctccgcctgaactctgtcctgaagctg
gccgtgctgctgattatgatcgccatctatgcgctgctgactgagaccgtctacgcgggc
ctcttcctgcgctatgacaacctaaaccacagcggagaagatttcctggggaccaaggag
gcgtcactgctgctgatggccatgttcctccttgccgtgttctaccacggacagcagctg
gagtacacggcccgcctggacttcctttggcgagtgcaggccaaagaggagatcaacgag
atgaaggagctcagggagcacaatgagaacatgctccggaacattctacccagccacgtg
gcccgccacttcctggagaaagaccgagacaacgaggagctgtattcccaatcttatgat
gccgtcggggtgatgttcgcctccatcccggggtttgcagacttttactctcagactgag
atgaataaccaaggggtagaatgcctgcgtctgttgaatgagatcattgctgacttcgat
gagctgctaggcgaagaccggtttcaggacattgaaaagattaagaccatcggcagcacc
tacatggccgtgtcgggcctgtcacctgaaaaacagcaatgtgaagacaagtggggacat
ctgtgtgccctggccgacttctccctcgccctgaccgaaagcatacaggagatcaacaaa
cattccttcaacaatttcgaactccggattggcatcagtcacggctccgtggtagctggg
gtcatcggcgctaagaagccacaatatgacatttggggcaaaactgtgaacctggcgagc
cgaatggacagcacaggggtcagcggcaggatccaagtccccgaggagacctatctcatc
ctgaaggaccagggctttgccttcgactaccgaggggagatctacgtgaagggcatcagt
gagcaggaaggaaaaatcaaaacgtactttctcctgggaagagtccaacccaacccgttc
atcctgcccccgagaagactgcccgggcagtactcactggccgcggtcgtcctgggcctt
gtccagtccctcaacaggcaaaggcagaagcagttgctcaatgagaacatcaacacaggg
atcatcaagggccattacaaccggcggactttgctgacagccagtgggccagagcccggg
gcccaggctgagggcgccgacaagtccgacttgccatga

KEGG   Panthera pardus (leopard): 109278247Help
Entry
109278247         CDS       T06062                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04020  Calcium signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04727  GABAergic synapse
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04961  Endocrine and other factor-regulated calcium reabsorption
ppad04962  Vasopressin-regulated water reabsorption
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05032  Morphine addiction
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109278247 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109278247 (ADCY9)
   04371 Apelin signaling pathway
    109278247 (ADCY9)
   04020 Calcium signaling pathway
    109278247 (ADCY9)
   04072 Phospholipase D signaling pathway
    109278247 (ADCY9)
   04024 cAMP signaling pathway
    109278247 (ADCY9)
   04022 cGMP-PKG signaling pathway
    109278247 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109278247 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109278247 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109278247 (ADCY9)
   04062 Chemokine signaling pathway
    109278247 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    109278247 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    109278247 (ADCY9)
   04912 GnRH signaling pathway
    109278247 (ADCY9)
   04913 Ovarian steroidogenesis
    109278247 (ADCY9)
   04915 Estrogen signaling pathway
    109278247 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    109278247 (ADCY9)
   04921 Oxytocin signaling pathway
    109278247 (ADCY9)
   04926 Relaxin signaling pathway
    109278247 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    109278247 (ADCY9)
   04918 Thyroid hormone synthesis
    109278247 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    109278247 (ADCY9)
   04916 Melanogenesis
    109278247 (ADCY9)
   04925 Aldosterone synthesis and secretion
    109278247 (ADCY9)
   04927 Cortisol synthesis and secretion
    109278247 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109278247 (ADCY9)
   04270 Vascular smooth muscle contraction
    109278247 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    109278247 (ADCY9)
   04971 Gastric acid secretion
    109278247 (ADCY9)
   04972 Pancreatic secretion
    109278247 (ADCY9)
   04976 Bile secretion
    109278247 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109278247 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109278247 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    109278247 (ADCY9)
   04727 GABAergic synapse
    109278247 (ADCY9)
   04725 Cholinergic synapse
    109278247 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    109278247 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109278247 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    109278247 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    109278247 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109278247 (ADCY9)
   04714 Thermogenesis
    109278247 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109278247 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    109278247 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109278247 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109278247 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109278247 (ADCY9)
   05163 Human cytomegalovirus infection
    109278247 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109278247 (ADCY9)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109278247 (ADCY9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2 AC_N
Motif
Other DBs
NCBI-GeneID: 109278247
NCBI-ProteinID: XP_019323964
Ensembl: ENSPPRG00000010573
Position
Unknown
AA seq 1352 aa AA seqDB search
MASPPHQQLLRHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
AGVPRRVGAGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACMERCFPQTRRRFRYAL
FYIGFACLLWSIYFGVHMRSRLIVMVAPALCFLVVCGGFFLFTFTKVYARHYVWTSLVLT
LLVFALTLAAQFQVLTPLSGRVDSSNHTLATKPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDKDCFPPPEAGAPHWELLSRALLHVCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIDEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGRVTERLGQSVVADQLKGLKTYLIAGQRAKESRCSCSEALLSGYEVIDGSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAVQNGCQEEHKN
STKAPGAPNSKTQNGLLSPPHEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGAASMPPPPAALAVFGAALLLEVLSLVVSVR
MVFFLEDVMACTKRLLERIAGWLPRHFIGAILVSLPALAVYSHITSEFDTDIHFTVFAGS
AILTAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYISLCPDSSVVISHLDVGQNFSSKG
NPCNSSLPHDGRAASLIGQEGVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKI
QSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKEC
YRVLNELIGDFDELLSRPGYGSIEKIKTIGATYMAASGLNGAQCRDGSHPQEHLQVLFEF
AKEMMRVVDDFNSNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTG
VECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDSGAVPQHQLSISPD
IRVQVDGSIGRSPTDEIANLVPSVQSADKTPPGSENNVQARDAHLSSKRPWKEPVKAEER
CRFGKAIEKSDCEDADAEEASELTRLNVSESV
NT seq 4059 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcggcaccacagcacggaggtgagctgtgac
tccagcggagacagcaacagcgtgagggtcaaaatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaagtacagcatctcctccagctgtagcagctctggggactcg
gcaggcgtcccccggagagtgggcgctggaggccgcctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccggtggtgggaccccaagttcgactcggtgaacctg
gaggaggcttgcatggagcgctgcttcccgcagacccggcgccgcttccggtatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttggggtccacatgcggtcc
cgcctgattgtcatggtagcccctgctctgtgcttcctcgtcgtgtgtgggggctttttt
ctgtttaccttcaccaaggtgtatgcccggcattacgtgtggacctccctggttctcacc
ctcctggtgtttgccctgaccctggctgcccagtttcaggttctgacgcctctctcagga
cgtgttgacagctccaatcacaccctcgccaccaagcccacggacacttgtttgtctcaa
gtggggagcttttccatgtgcatcgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgtgtttgggagtggcctattctgttctctttgagacctttggc
tatcacttccgagacaaagactgctttcccccacccgaagcaggggccccacactgggag
ctgctgagcagagccctgctccacgtctgcattcacgccattgggatccacctcttcatc
atgtcccaggtgagatccaggagcacctttctcaaggtgggacagtcaattatgcacgga
aaggatctggaagtggaaaaagccctgaaagagaggatgattcattctgtgatgccaaga
atcatagctgatgacttgatgaaacagggggatgaggagagcgagaattctgtcaaaagg
cacgccacctccagccccaagaacaggaagaaaaagtcttccatacagaaagcccctata
gcgttccgcccttttaaaatgcagcagatcgatgaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaataagtccgctcacgccctggtgggtctcctcaac
gatctgttcggtcgctttgaccggttgtgtgaagagaccaagtgtgagaaaatcagcacc
ctgggagactgctactattgcgtggcagggtgtccagagccccgggctgaccatgcctac
tgctgcattgagatgggcttgggcatgatcagagccatcgagcagttctgccaggagaag
aaagagatggtgaacatgcgtgtcggggttcacacggggaccgtcttgtgtggcattttg
ggcatgaggaggttcaaattcgatgtgtggtccaatgatgtgaacttggccaatctcatg
gagcagctgggagttgccggcaaggttcacatttctgaggccactgcaaaatacctagat
gatcggtacgaaatggaagacgggagggtgactgaacggctcggccagagcgttgttgct
gatcagctgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcgt
tgcagctgttcagaggccttgctttctggctatgaggtcattgacggctcacgggtgtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcgtgcggaatcacgttcgcccccaaa
tcggaagctggtgcggaaggaggagcggtccaaaacggctgtcaagaggagcataaaaac
agcaccaaggctcctggagctcctaattccaaaactcaaaatggacttctgagtcctccc
catgaggagaagctcaccaacagtcagacctccctgtgtgagatcttacaggaaaaggga
aggtgggcaggagtgagcttggaccagtcagctctccttccgctgagattcaagaacatc
cgggagaaaacagacgcccattttgttgatgttatcaaagaagacagcctgatgaaggat
tattttttcaagccacccatcaatcagttcagcttgaacttcctggatcaggagctagag
cgatcctatcggaccagctatcaagaagaggttataaagaattctcccgtgaagactttt
gccagcgccaccttcagctccctcctggatgtgtttctgtcgacgacagtgtttctgatt
ctgtccatcacctgcttcctgaagtacggggctgcctccatgcctcccccgcccgccgcc
ctggctgtcttcggtgccgccctgctgctggaggtgctgtccctcgtggtctccgtcagg
atggtgtttttcctggaggatgtgatggcttgtaccaagcgcctgctggagcggatagcc
ggctggctcccgcgccatttcattggggccatcctggtgtcactccctgctctcgctgtc
tattcacatatcacctctgaatttgacaccgacatacacttcaccgtgtttgcgggctcc
gccatcctgaccgctgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccttagccaccgtcgtcggggctgggccgctgctcctgctctacatctccctttgc
ccggacagttccgtagtaatttcacacctggatgtgggacagaatttcagttccaagggg
aatccgtgcaacagttccttgccgcatgacggcagagcagccagcctgattggccaggag
ggggttcttgtcttctttctcctgctcttgttggtctggttcctgaatcgagaattcgag
gtcagctaccgcctgcactaccacggggatgtggaggcggacctccaccgcaccaagatc
cagagcatgagggaccaagctgactggctgctgagaaacatcatcccctaccacgtggct
gagcagctgaaggtctcccagacctactccaagaaccacgacagcgggggcgtcatcttt
gccagcatcgtcaacttcagcgagttctacgaggagaactacgaggggggcaaggagtgc
taccgcgtcctcaacgagctcatcggggacttcgacgagctcctgagcaggccgggctac
ggcagcatcgagaagatcaagaccatcggagccacgtacatggctgcgtcagggctgaac
ggcgcgcagtgccgggacggcagccacccgcaggagcacctgcaggtcctgtttgagttc
gccaaggagatgatgcgcgtggtggacgacttcaacagcaacatgctgtggttcaacttc
aagctcagggtgggcttcaaccacgggccgctcacggcgggggtcatcggcaccaccaag
ctgctctatgacatctggggcgacaccgtcaacatcgccagcaggatggacagcacgggg
gtggagtgccggatccaggtgagcgaggagagctaccgcgtcctgagcaagatgggctat
gacttcgactaccgagggacggtgaacgtcaagggcaagggccagatgaagacctacctg
tacccaaagtgcacggacagcggggccgtgccgcagcaccagctgtccatctccccggac
atccgagtccaggtggacggcagcatcgggcggtctcccacggacgagatcgccaacctg
gtgccttctgtccagagtgcggacaagacgcctccgggttccgaaaacaacgtgcaggcc
agggatgctcacctgtcctctaagaggccctggaaggagcctgtcaaagccgaagaaagg
tgtcgatttggcaaagccatagagaaaagcgactgtgaagacgcggacgctgaagaagcc
agtgagctcaccaggctcaacgtttctgagagcgtgtga

DBGET integrated database retrieval system