KEGG   Panthera pardus (leopard): 109249057Help
Entry
109249057         CDS       T06062                                 

Gene name
PRKAG1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04068  FoxO signaling pathway
ppad04152  AMPK signaling pathway
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04371  Apelin signaling pathway
ppad04530  Tight junction
ppad04710  Circadian rhythm
ppad04714  Thermogenesis
ppad04910  Insulin signaling pathway
ppad04920  Adipocytokine signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04922  Glucagon signaling pathway
ppad04931  Insulin resistance
ppad04932  Non-alcoholic fatty liver disease (NAFLD)
ppad05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109249057 (PRKAG1)
   04068 FoxO signaling pathway
    109249057 (PRKAG1)
   04152 AMPK signaling pathway
    109249057 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109249057 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109249057 (PRKAG1)
   04922 Glucagon signaling pathway
    109249057 (PRKAG1)
   04920 Adipocytokine signaling pathway
    109249057 (PRKAG1)
   04921 Oxytocin signaling pathway
    109249057 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    109249057 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    109249057 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    109249057 (PRKAG1)
   04714 Thermogenesis
    109249057 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    109249057 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109249057 (PRKAG1)
   04931 Insulin resistance
    109249057 (PRKAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS DRTGG Cbl_N3 DUF2497
Motif
Other DBs
NCBI-GeneID: 109249057
NCBI-ProteinID: XP_019274769
Ensembl: ENSPPRG00000009137
Position
Unknown
AA seq 374 aa AA seqDB search
MGRDLSALHPSRPAPRELPKASEPSLRLLKWRRLLLQIAPQLWKMSILKLMHGRKLLTIP
PYAETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWD
SKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNA
SLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEEL
QIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYN
NLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLS
DILQALVLTGGEKP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggggcgggacctgtccgccctccacccctcccgcccggctcccagagagcttcctaaa
gcgagcgagcccagtctgcgcctcttgaaatggagacggttgcttcttcagattgctccc
cagctctggaaaatgagcattctcaagttgatgcatggaaggaagcttctaactatccca
ccctatgcagagaccccagaatccaacaatagtgtgtatacttccttcatgaagtctcat
cgctgctatgacctgattcccacaagctccaaattggttgtatttgatacttccctgcag
gtgaagaaagctttctttgctttggtgactaatggtgtacgggctgcccctttgtgggat
agtaagaagcaaagttttgtgggcatgctgaccatcaccgatttcatcaatatcctgcat
cgctactataaatcagccttggtacagatctatgagctggaagaacacaagatagaaact
tggagagaggtgtacctacaggactccttcaaaccacttgtctgcatttctcctaatgcc
agcttgtttgatgctgtctcttcattaattcgaaacaagatccacaggctgccagttatt
gacccagaatcaggcaacaccttgtacatccttacccacaagcgtatcctcaagttcctc
aaactgtttatcactgagttccccaagccagagttcatgtctaagtctctggaagagcta
cagattggcacctatgctaacattgctatggtccgcaccaccacccctgtctacgtggct
ctgggcatctttgtacaacaccgagtttcagcactgccagtagtagatgagaaagggcgt
gtggtggacatctactccaagtttgatgttatcaatctggcagcagaaaagacctacaac
aacttagatgtgtctgtgacgaaagccctccaacatcgatcacattactttgagggtgtc
ctcaagtgttacctgcatgagactctggagaccatcatcaacaggctggtggaagcagag
gttcaccgacttgtagtggtagatgagaatgatgtggtcaaggggattgtatcactgtct
gacatcctgcaggccctggtgctcacaggaggagagaagccctga

KEGG   Panthera pardus (leopard): 109252396Help
Entry
109252396         CDS       T06062                                 

Gene name
PRKAG2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04068  FoxO signaling pathway
ppad04152  AMPK signaling pathway
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04371  Apelin signaling pathway
ppad04530  Tight junction
ppad04710  Circadian rhythm
ppad04714  Thermogenesis
ppad04910  Insulin signaling pathway
ppad04920  Adipocytokine signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04922  Glucagon signaling pathway
ppad04931  Insulin resistance
ppad04932  Non-alcoholic fatty liver disease (NAFLD)
ppad05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109252396 (PRKAG2)
   04068 FoxO signaling pathway
    109252396 (PRKAG2)
   04152 AMPK signaling pathway
    109252396 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109252396 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109252396 (PRKAG2)
   04922 Glucagon signaling pathway
    109252396 (PRKAG2)
   04920 Adipocytokine signaling pathway
    109252396 (PRKAG2)
   04921 Oxytocin signaling pathway
    109252396 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    109252396 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    109252396 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    109252396 (PRKAG2)
   04714 Thermogenesis
    109252396 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    109252396 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109252396 (PRKAG2)
   04931 Insulin resistance
    109252396 (PRKAG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3
Motif
Other DBs
NCBI-GeneID: 109252396
NCBI-ProteinID: XP_019280371
Ensembl: ENSPPRG00000017828
Position
Unknown
AA seq 475 aa AA seqDB search
MSFSGIFRSSSKESSPNSNPSTSPGGIRFFSRSRKSSVRLTVESGDPASNTLLSTAPKRR
ATASGLSSSPSTPTQVAKQHTFPLESYKHEPERLENRIYASTSPPDTGQRYCPSSFQSTA
GPPSASPTHHASSRTAALAAAPGPAEAGMLEKFELEEEAEDSESGVYMRFMRSHKCYDIV
PTSSKLVVFDTTLQVKKAFFALVANGVRAAPLWESKKQSFVGMLTITDFINILHRYYKSP
MVQIYELEEHKIETWRELYLQETFKPLVNISPDASLFDAVYSLIKNKIHRLPVIDPISGN
ALYILTHKRILKFLQLFMSDMPKPAFMKQNLDALGIGTYHNIAFIHPDTPIIKALNVFVE
RRVSALPVVDESGKVVDIYSKFDVINLAAEKTYNNLDITVTQALQHRSQYFEGVVKCSKL
EILETIVDRIVRAEVHRLVVVNEADSIVGIISLSDILQALILTPAGAKQKETETE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagtgggatctttcgctcctcctccaaagaatcttcccccaactccaacccg
tctacctcgcccgggggcatcaggttcttctcccgctccagaaaaagttcggtgaggctg
accgtcgagtccggggaccctgcctcaaatactttgttgtccacagcccccaagaggagg
gccacagcctcaggcctctcctcctctccgtccacacccacccaagtggccaagcagcac
acgtttcctctcgaatcctacaagcatgagcctgagcgactggaaaatcgcatctatgcc
tccacttcccctccggacacaggccagaggtactgcccgtcctccttccagagcacagcc
gggcctccatcggcatcgcccacgcaccatgcttcctccagaaccgcggcgctggcggcg
gccccgggacccgcggaagccggcatgctggagaaattcgagttggaagaagaagcagaa
gactcagagagtggcgtctacatgcgcttcatgaggtcacacaagtgttacgacatcgtt
cccaccagttcaaagcttgtggtgtttgatacaacgttacaagtgaaaaaggccttcttt
gccttagtagccaatggtgtccgagcagcgccgctgtgggagagtaagaaacaaagtttt
gtaggaatgctaacaattacagatttcataaatatactacatagatactataaatcaccc
atggtacagatctatgaattagaggaacataagattgaaacatggagggagctttattta
caagaaacatttaagcctttagtgaatatatctccagatgcaagcctcttcgatgctgta
tactcgttgatcaaaaataaaatccacagattgccagttattgaccctatcagtgggaat
gcactttatatacttacccacaaaagaatcctcaagttcctccagctttttatgtctgat
atgccaaagcctgccttcatgaagcagaacctagacgcccttggcatcgggacctaccac
aacatcgccttcatccacccggacactcccatcattaaagccttgaacgtctttgtagaa
agacgagtgtcggccttgcctgtggtggatgagtcaggaaaagttgtagatatttattcc
aaatttgatgtcattaaccttgctgctgagaagacgtacaataacctagatatcacagtg
acccaggcccttcagcaccgctcacagtactttgagggcgtcgtgaagtgcagtaagctg
gaaatactggagaccatcgtggacagaatagtgcgggccgaggtgcatcggctggtggta
gtaaatgaagcagatagcatcgtgggtattatctccctgtcagacattctgcaggccctg
atactcacgcccgcaggtgccaaacaaaaggagacggaaacggaatga

KEGG   Panthera pardus (leopard): 109259142Help
Entry
109259142         CDS       T06062                                 

Gene name
PRKAB2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2 isoform X1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04068  FoxO signaling pathway
ppad04152  AMPK signaling pathway
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04371  Apelin signaling pathway
ppad04530  Tight junction
ppad04710  Circadian rhythm
ppad04714  Thermogenesis
ppad04910  Insulin signaling pathway
ppad04920  Adipocytokine signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04922  Glucagon signaling pathway
ppad04931  Insulin resistance
ppad04932  Non-alcoholic fatty liver disease (NAFLD)
ppad05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109259142 (PRKAB2)
   04068 FoxO signaling pathway
    109259142 (PRKAB2)
   04152 AMPK signaling pathway
    109259142 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109259142 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109259142 (PRKAB2)
   04922 Glucagon signaling pathway
    109259142 (PRKAB2)
   04920 Adipocytokine signaling pathway
    109259142 (PRKAB2)
   04921 Oxytocin signaling pathway
    109259142 (PRKAB2)
  09149 Aging
   04211 Longevity regulating pathway
    109259142 (PRKAB2)
   04213 Longevity regulating pathway - multiple species
    109259142 (PRKAB2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    109259142 (PRKAB2)
   04714 Thermogenesis
    109259142 (PRKAB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    109259142 (PRKAB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109259142 (PRKAB2)
   04931 Insulin resistance
    109259142 (PRKAB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 109259142
NCBI-ProteinID: XP_019292046
Ensembl: ENSPPRG00000010492
Position
Unknown
AA seq 272 aa AA seqDB search
MGNTTSDRVAGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKHTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaccaccagcgaccgggtggctggggagcgccacggcgccaaggctgcacgc
tccgagggtgccggcggccatgcgccgggtaaggagcacaaaatcatggtggggagtacc
gacgatcccagcgtcttcagcctgccggactccaagctccctggggacaaagaatttgta
tcatggcaacaagatttggaggactccgtaaagcatacacagcaggcccggcccactgtt
atccgctggtctgaaggaggcaaggaggtcttcatctctgggtccttcaacaattggagc
accaagattccactgattaagagccataatgactttgttgccatcttagacctccctgag
ggagagcaccagtacaagttttttgtggatggacaatgggttcatgatccgtcagagcct
gtggttaccagtcagcttggcacaattaacaatttgatccatgtcaagaaatctgacttt
gaggtgtttgatgctttaaagctagattcaatggaaagctcagagacatcttgtcgagac
ctttccagctctcccccagggccttatggtcaagaaatgtacgtgtttcgatccgaggag
agattcaaatccccacccatcctacctcctcaccttcttcaagttattcttaacaaggac
actaatatatcttgtgacccagccttgcttcccgagcccaaccatgttatgctgaaccat
ctctatgcattatccattaaggacagtgtgatggtccttagcgcaacccatcgctacaag
aagaagtatgtcactactctgctgtacaagcccatctga

KEGG   Panthera pardus (leopard): 109265053Help
Entry
109265053         CDS       T06062                                 

Gene name
PRKAG3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04068  FoxO signaling pathway
ppad04152  AMPK signaling pathway
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04371  Apelin signaling pathway
ppad04530  Tight junction
ppad04710  Circadian rhythm
ppad04714  Thermogenesis
ppad04910  Insulin signaling pathway
ppad04920  Adipocytokine signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04922  Glucagon signaling pathway
ppad04931  Insulin resistance
ppad04932  Non-alcoholic fatty liver disease (NAFLD)
ppad05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109265053 (PRKAG3)
   04068 FoxO signaling pathway
    109265053 (PRKAG3)
   04152 AMPK signaling pathway
    109265053 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109265053 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109265053 (PRKAG3)
   04922 Glucagon signaling pathway
    109265053 (PRKAG3)
   04920 Adipocytokine signaling pathway
    109265053 (PRKAG3)
   04921 Oxytocin signaling pathway
    109265053 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    109265053 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    109265053 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    109265053 (PRKAG3)
   04714 Thermogenesis
    109265053 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    109265053 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109265053 (PRKAG3)
   04931 Insulin resistance
    109265053 (PRKAG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS
Motif
Other DBs
NCBI-GeneID: 109265053
NCBI-ProteinID: XP_019301481
Ensembl: ENSPPRG00000008754
Position
Unknown
AA seq 562 aa AA seqDB search
MEHALSRNPSWSSLGGPERQEMSCLEQGENTSWPSPAMTTGSERSHEKQGTKASRWTRQE
AVAEGELPGLGEDPQAKPPAEYAGLEATFPKATHLSQAAPLAKVGAPPTEWDIFPPNHEA
SAAGSSTDELELDIGFPATASWGYELGLVEERPALCPSPRALLPRLGWDDELQKPGALVY
MHFMQEHTCYDAMATSSKLVIFDTTLEIKKAFFALVANGIRAAPLWDSKKQSFVGMLTIT
DFILVLHRYYRSPLVQIYEIEEHKIETWREIYLQGCFKPLVSISPSSSLFEAVYTLIKNR
IHRLPVLDPVSGAVLHILTHKRLLKFLHIFGSLLPQPSFLSRTIQDLGIGTFRDLAVVLD
TAPILTALDIFVDRRVSALPVVNEAGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEALKQR
TLCLEGVLSCQPHESLGEVIDRIAREQASPALCHCPCPACAPRSPQEFPVLHGMMKLRTA
ESSLEIYEPEALRLPQGCLLHAYPYHFPPHWPQWSSEPSASWVYSGALDSSASGLPGRPC
YSSTLLRVAPHNLATALLPSQH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggagcacgcactgagccggaacccatcctggagcagccttgggggacctgagcgtcaa
gagatgagctgtctagaacaaggagagaacacttcatggccatcgccggccatgaccaca
ggctcagaaagaagccatgagaaacaggggaccaaggcctcgaggtggacaaggcaggag
gctgtggcggaaggggagctgccgggtctgggggaagatccccaggccaagccacctgct
gagtacgccgggctggaggccacgttccccaaggccacacacttgtcccaggctgctcct
ttggccaaagtgggcgccccaccaacagagtgggacatcttcccccctaaccacgaagcc
tcggccgctggctccagcacagacgagctggagctggacatagggttcccagccacagca
tcgtgggggtatgagctcggcctggtggaagagaggcctgccctgtgcccatccccacgg
gccctgttacccaggctgggctgggacgacgaactgcagaagccgggggccctggtctac
atgcacttcatgcaggagcacacctgctacgacgccatggcaaccagttccaagctggtc
atcttcgacaccacgctggagatcaagaaggccttctttgccctagtggccaacggcatc
cgggcggcaccgctgtgggacagcaagaagcagagcttcgtggggatgctgaccatcaca
gacttcatcctggtgctgcatcgctattacaggtccccgctggtccagatctatgagatt
gaagaacataagattgagacctggagagagatctaccttcaaggctgcttcaagcctctg
gtctccatttctcccagcagcagcctgttcgaagccgtctacaccctcatcaagaaccgg
atccaccgtctgccggtcctggacccggtctcaggcgccgtgctccacatcctcacacac
aagcgactgctcaagttcctgcacatctttggctccctgctgccccagccctccttcctc
tcccgcaccatccaagatctgggcatcggcacattccgagacttggccgtggtgctggac
acggcgcccatcctgacggccctggacatctttgtggaccggcgtgtgtctgcgctgcct
gtggtcaacgaagctggacaagtcgtgggcctctactcccgcttcgatgtgattcacctg
gctgcccagcaaacctacaaccacctggacatgagtgtgggcgaagccctgaagcagagg
acactgtgtctggaaggagtcctttcctgccagccccatgagagcttgggggaagtcatc
gaccggattgcccgggagcaggcttcaccagccctctgtcattgcccttgccctgcctgt
gctcccagaagccctcaggaattcccagtcctccatgggatgatgaaattaagaacagct
gagtcgagcctggagatctatgaaccagaggcactgagattaccccagggctgcctgctc
catgcctacccatatcactttcccccccactggccccagtggagcagcgagccctcagcc
agttgggtgtattcaggggctctggattcctcagcttctggactacctgggaggccctgc
tattcttccacactactaagggtggctccccacaacttggccactgcccttcttccctcc
cagcattga

KEGG   Panthera pardus (leopard): 109266797Help
Entry
109266797         CDS       T06062                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04068  FoxO signaling pathway
ppad04140  Autophagy - animal
ppad04150  mTOR signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04152  AMPK signaling pathway
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04371  Apelin signaling pathway
ppad04530  Tight junction
ppad04710  Circadian rhythm
ppad04714  Thermogenesis
ppad04910  Insulin signaling pathway
ppad04920  Adipocytokine signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04922  Glucagon signaling pathway
ppad04931  Insulin resistance
ppad04932  Non-alcoholic fatty liver disease (NAFLD)
ppad05410  Hypertrophic cardiomyopathy (HCM)
ppad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109266797 (PRKAA2)
   04068 FoxO signaling pathway
    109266797 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    109266797 (PRKAA2)
   04152 AMPK signaling pathway
    109266797 (PRKAA2)
   04150 mTOR signaling pathway
    109266797 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109266797 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109266797 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109266797 (PRKAA2)
   04922 Glucagon signaling pathway
    109266797 (PRKAA2)
   04920 Adipocytokine signaling pathway
    109266797 (PRKAA2)
   04921 Oxytocin signaling pathway
    109266797 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    109266797 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    109266797 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    109266797 (PRKAA2)
   04714 Thermogenesis
    109266797 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109266797 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    109266797 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109266797 (PRKAA2)
   04931 Insulin resistance
    109266797 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppad01001]
    109266797 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppad04131]
    109266797 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:ppad03029]
    109266797 (PRKAA2)
Enzymes [BR:ppad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     109266797 (PRKAA2)
Protein kinases [BR:ppad01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   109266797 (PRKAA2)
Membrane trafficking [BR:ppad04131]
 Autophagy
  Other autophagy associated proteins
   Others
    109266797 (PRKAA2)
Mitochondrial biogenesis [BR:ppad03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    109266797 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    109266797 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 109266797
NCBI-ProteinID: XP_019304697
Ensembl: ENSPPRG00000007154
Position
Unknown
AA seq 552 aa AA seqDB search
MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEVEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSAMHIP
PGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVMEQR
SGSSTPQRSCSAAGLHRPRSSFDSVTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFF
EMCASLITTLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgggtgaagatcggacactacgtgctgggtgac
acgctgggcgtcggcaccttcggcaaagtgaagattggagaacatcaattgacaggccat
aaagtggcagttaaaatcttaaatagacagaagattcgcagtttagatgttgttggaaaa
ataaaacgagaaattcaaaatctaaaactctttcgccatcctcatattatcaaactatac
caggtgatcagcactccaacagatttttttatggtaatggaatatgtgtctggtggtgaa
ttatttgactacatctgtaaacatggacgggttgaagaggtggaagcaaggcgcctcttt
cagcagattctgtcagctgtggattactgtcataggcatatggtagttcatcgagacctg
aaaccagagaatgtgctgttggatgctcacatgaatgccaagatagcggattttggattg
tctaatatgatgtcggatggtgagtttctgcgaactagttgtggatctcccaattatgca
gcacctgaagtcatctcaggcagattgtatgcaggtcctgaagttgatatctggagctgt
ggtgttatcttgtatgctctcctttgtggcaccctcccatttgacgatgagcatgtacct
acgttatttaagaagatccgagggggtgttttttatatcccagaatatctcaatcgttct
gttgccactctgttgatgcatatgctgcaggttgaccccctgaaacgggcaactatcaaa
gatataagagagcatgaatggtttaaacaagatttgcccagttacttatttcctgaagac
ccttcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaaaaattt
gagtgtacagaatcagaagtaatgaacagtttatatagtggtgaccctcaagaccagctt
gcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagtgagttc
tacctcgcctctagtcccccaactggttcttttatggatgatagtgccatgcatattccc
ccaggcctgaagcctcatccagaaaggatgccacctcttatagcagacagccctaaagca
agatgtccattggatgcgctgaatacaactaagcccaaatctttagctgtgaaaaaagcc
aagtggcatcttggaatcagaagtcaaagcaaaccatatgatattatggccgaagtctac
cgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatcttcgtgta
agaaggaaaaatccagtgactggcaattatgtgaaaatgagcttacagctttacctggtt
gacaacagaagctatcttttggactttaaaagcattgatgatgaggtgatggagcagagg
tctggttcgtcaacacctcagcgttcctgttcagctgctggcttacacagacccagatca
agttttgattctgtaacagcagagagtcattcactctctggctctcttactggctccttg
acaggaagcacactgtcttctgtttcacctcgcctaggcagtcacaccatggattttttt
gaaatgtgtgctagtctgatcactactttggcccgttga

KEGG   Panthera pardus (leopard): 109275841Help
Entry
109275841         CDS       T06062                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04068  FoxO signaling pathway
ppad04140  Autophagy - animal
ppad04150  mTOR signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04152  AMPK signaling pathway
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04371  Apelin signaling pathway
ppad04530  Tight junction
ppad04710  Circadian rhythm
ppad04714  Thermogenesis
ppad04910  Insulin signaling pathway
ppad04920  Adipocytokine signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04922  Glucagon signaling pathway
ppad04931  Insulin resistance
ppad04932  Non-alcoholic fatty liver disease (NAFLD)
ppad05410  Hypertrophic cardiomyopathy (HCM)
ppad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109275841 (PRKAA1)
   04068 FoxO signaling pathway
    109275841 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    109275841 (PRKAA1)
   04152 AMPK signaling pathway
    109275841 (PRKAA1)
   04150 mTOR signaling pathway
    109275841 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109275841 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109275841 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109275841 (PRKAA1)
   04922 Glucagon signaling pathway
    109275841 (PRKAA1)
   04920 Adipocytokine signaling pathway
    109275841 (PRKAA1)
   04921 Oxytocin signaling pathway
    109275841 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    109275841 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    109275841 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    109275841 (PRKAA1)
   04714 Thermogenesis
    109275841 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109275841 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    109275841 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109275841 (PRKAA1)
   04931 Insulin resistance
    109275841 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppad01001]
    109275841 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppad04131]
    109275841 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:ppad03029]
    109275841 (PRKAA1)
Enzymes [BR:ppad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     109275841 (PRKAA1)
Protein kinases [BR:ppad01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   109275841 (PRKAA1)
Membrane trafficking [BR:ppad04131]
 Autophagy
  Other autophagy associated proteins
   Others
    109275841 (PRKAA1)
Mitochondrial biogenesis [BR:ppad03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    109275841 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    109275841 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like Kdo FTA2 APH YukC
Motif
Other DBs
NCBI-GeneID: 109275841
NCBI-ProteinID: XP_019319779
Ensembl: ENSPPRG00000007500
Position
Unknown
AA seq 574 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RKSDVPGVVRTGSMKELDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAK
IADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPF
DDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPK
YLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIM
NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA
KWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQV
DSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRNDSDADAQGKSSEASLTSSV
TSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacatcctgggggacacgctgggcgtcggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcacaaagttgctgtgaagatactcaatcga
cagaagattcgaagccttgatgtggtaggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggaaatctgatgtacctggagtagtaagaacaggctccatgaaggagctggatgaaaaa
gaaagtcggcgtctgtttcaacaaatcctttctggtgtggattactgtcacaggcatatg
gtggtccatagagatttgaaacctgaaaatgtcctgcttgatgcacacatgaatgcaaag
atagctgattttggtctttcaaacatgatgtcagatggtgaatttttaagaacaagctgt
ggctcacccaactatgctgcaccagaagtaatttcaggaagattgtatgcaggtccagag
gtagacatatggagcagtggggttattctctatgctttattatgtggaacccttccgttt
gatgatgatcatgtgccaactctttttaagaagatatgtgatgggatcttttatacccct
cagtatttaaatccatctgtgattagccttttgaaacatatgctacaggtggatcccatg
aagagggccacaatcaaagatatcagggagcatgaatggtttaaacaagatcttccaaaa
tatctctttcctgaggatccatcatatagttcaaccatgattgatgatgaagccttaaaa
gaagtgtgtgaaaaatttgaatgctcagaagaggaggttctcagctgcctttataataga
aatcaccaggacccgttggcagttgcctatcacctcataatagataacaggaggataatg
aatgaggccaaagatttttacttggcaacaagcccacctgattcttttctcgatgatcat
catttgactcggccgcatcctgaaagagtaccattcttggttgctgaaacgccaagggca
cgccacaccctcgatgaattaaacccacagaaatcaaaacaccaaggtgtaaggaaagca
aaatggcatttgggaattagaagtcaaagtcgaccgaatgatatcatggcagaagtttgt
agagcaattaaacaactggattacgaatggaaggttgtaaacccatattatttgcgtgtt
cgaaggaagaatcctgtaacaagtacatactccaaaatgagtctacagttataccaagtg
gatagtagaacgtacttactggatttccgtagtattgatgatgaaattactgaagccaaa
tcagggactgctactccacagagatcaggatcagttagcaactatcgatcttgccaaagg
aatgattcagatgctgatgctcaaggaaaatcctcagaagcttcacttacctcatctgtg
acctcacttgactcttctcctgttgacttaactccaagacctggaagtcacacgatagaa
ttttttgaaatgtgtgcgaatctaattaaaattcttgcacagtaa

KEGG   Panthera pardus (leopard): 109277549Help
Entry
109277549         CDS       T06062                                 

Gene name
PRKAB1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04068  FoxO signaling pathway
ppad04152  AMPK signaling pathway
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04371  Apelin signaling pathway
ppad04530  Tight junction
ppad04710  Circadian rhythm
ppad04714  Thermogenesis
ppad04910  Insulin signaling pathway
ppad04920  Adipocytokine signaling pathway
ppad04921  Oxytocin signaling pathway
ppad04922  Glucagon signaling pathway
ppad04931  Insulin resistance
ppad04932  Non-alcoholic fatty liver disease (NAFLD)
ppad05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109277549 (PRKAB1)
   04068 FoxO signaling pathway
    109277549 (PRKAB1)
   04152 AMPK signaling pathway
    109277549 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109277549 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109277549 (PRKAB1)
   04922 Glucagon signaling pathway
    109277549 (PRKAB1)
   04920 Adipocytokine signaling pathway
    109277549 (PRKAB1)
   04921 Oxytocin signaling pathway
    109277549 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    109277549 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    109277549 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    109277549 (PRKAB1)
   04714 Thermogenesis
    109277549 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    109277549 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109277549 (PRKAB1)
   04931 Insulin resistance
    109277549 (PRKAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Motif
Other DBs
NCBI-GeneID: 109277549
NCBI-ProteinID: XP_019322853
Ensembl: ENSPPRG00000003794
Position
Unknown
AA seq 270 aa AA seqDB search
MGNTSSERAALERQGGHKTPRRDSSGGAKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacacgagcagcgagcgggccgcgctggagcggcagggcggccacaagacgccg
cggagggacagctccgggggcgccaaggacggggacaggcccaagatcctgatggacagc
cccgaggacgccgacctcttccactccgaggaaatcaaggctccagagaaggaagaattc
ctggcttggcagcatgatctggaagtgaatgataaagcccctgcccaggctcggccaaca
gtatttcgatggacgggaggcggaaaggaagtttacttatccgggtccttcaacaactgg
agtaaacttcccctcacaagaagccacaataactttgtagccatcctggacctgcctgaa
ggagagcatcagtacaagttctttgtggatggtcagtggacacatgacccttctgagcca
atagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaactgacttt
gaagtatttgatgctttaatggtggattcccaaaagtgctccgatgtgtctgagctgtcc
agctccccaccaggaccctaccatcaggaaccctatgtctcaaaaccagaagaacggttt
aaggcaccacccattctccctccacatctgctccaggtcatcctgaacaaggacacgggg
atttcttgtgatccagctttgctccccgagcccaaccacgtcatgttgaaccacctttat
gcactctctatcaaggatggagtgatggtgctcagcgcgacccaccggtacaagaaaaag
tatgtcaccaccttgctatacaagcccatatga

DBGET integrated database retrieval system