KEGG   Panthera pardus (leopard): 109249097
Entry
109249097         CDS       T06062                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109249097 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ppad04040]
    109249097 (ASIC1)
Ion channels [BR:ppad04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   109249097 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 109249097
NCBI-ProteinID: XP_019274856
Ensembl: ENSPPRG00000015855
Position
Unknown
AA seq 559 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPHQLRQRDKSESEEEEEKEKEAVRKKAREGDSPM
DLVAFANSCTLHGTSHIFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVTL
LDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAFS
GEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRLK
TMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPG
FQTFVSCQEQRQLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILT
VLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtcattttcctctggagaggaagccccagggccc
ttgggagatgtttggggtccgcaccagctgcggcagcgggacaagtcagaatcagaagag
gaggaagagaaggaaaaggaggcagtgaggaagaaggctagagagggggattcgcccatg
gatttggtggcctttgccaacagctgcaccctgcatggcaccagccacatcttcgtggag
gggggtccagggccgaggcaggccttgtgggcagtggcctttgttctggcactgggtgcc
ttcttgtgccaggtaggggaccgcgttgcctattacctcagctacccgcacgtgactctg
ctagacgaggtggccaccacagagctggccttcccggcggtcaccctctgcaacactaat
gctgtgcggctgtcccagctcagctaccccgacttgctctacctggcccccatgctgggg
ctggatgaaagtgacgaccctggggtgcctctggccccaccggggcctgaggccttctct
ggggagccctttaacctgcaccgcttctacaatcgctcttgccaccggctggaggacatg
ctgctctattgttcctactgcggggggccctgtggcccccacaacttctcggtggtcttc
acacggtatggaaagtgctacacattcaactcgggccgagatgggcgtccacggctgaag
accatgaagggtgggactggcaatgggctggagatcatgctggacatccagcaggacgag
tacctgcccgtatggggagagactgatgagacgtccttcgaagcgggcatcaaagtgcag
atccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtggccccaggg
ttccagacctttgtgtcctgccaggagcagcggcagctcatctacctgcccccgccctgg
ggcacctgcaaagctgttaccatggactcggatttcttcgactcctacagcataactgcc
tgccgcatcgactgtgagacacgctacctggtggagaactgtaactgtcgcatggtgcac
atgccaggggatgccccatactgcactccagaacagtacaaggagtgtgcggatcctgct
ctggacttcctggtggagaaggaccaggaatactgtgtgtgtgaaatgccctgcaaccta
acccgctacggcaaggagctgtccatggtcaagatccccagcaaagcgtcagccaagtac
ctggccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggac
attttctttgaagtcctcaactatgagactattgagcagaagaaggcctatgaaattgca
gggctcctgggtgacattggaggccagatgggcctgttcattggggccagcatcctcaca
gtactggagctctttgactacgcctatgaggtcattaagcacaagctgtgcagaagagga
aagtgccagaaggaggccaaaaggagcagcgcggacaagggtgtggcccttagcctggat
gacgtcaaaagacataacccgtgtgagagcctccggggccatcctgctgggatgacgtat
gctgccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system