KEGG   Panthera pardus (leopard): 109251665
Entry
109251665         CDS       T06062                                 

Gene name
CUNH9orf3
Definition
(RefSeq) aminopeptidase O isoform X1
  KO
K09606  aminopeptidase O [EC:3.4.11.-]
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109251665 (CUNH9orf3)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109251665 (CUNH9orf3)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109251665 (CUNH9orf3)
SSDB
Motif
Pfam: Peptidase_M1 Peptidase_M1_N Cornifin Mtd_N
Other DBs
NCBI-GeneID: 109251665
NCBI-ProteinID: XP_019278998
Ensembl: ENSPPRG00000018024
Position
Unknown
AA seq 554 aa
MDTKLDPSRDDLPLMANTSHILVKHYVLDLDVDFESQIIEGTIVLFFESGNRFQKQSGST
KEPCRSESNEACRFRMPEPCHSPVTDTRTFSSKTRSNDFTICGKGEKDTSGKDGNHDNWE
QASGISSSKYCCDTGNHGSEDFLLVLDCCDLSVLKVEEVDVAAVPGIEKLTRSPKLTVVS
EELRNQIVCELVTLPADRWREQLDYYARCSQAPGCGELLFDTDTWSLQIRKTGAQTATDF
PHAIRIRYSTKPQGRSVTWTSDQSGRPCVYTMGSPINNRALFPCQEPPVAMSTWQATVRA
AASFVVLMSGENSAKPTQLREGCSSWHYYVTMPMPASTFTIAVGSWTEMKPETCSSNDLA
AERSLSPSEADFRYVGICGHMEYPCRFQNPSATTQEIIPHRVFAPVCLKAACQETLLQLV
PPCLSAAHRVLGTHPFSRLDILIVPGNFPSLGMASPHIIFLSQSVLTGNSHLCGTRLCHE
IAHAWFGLAIGARDWTEEWLSEGFATHLEDVFWAKAQQLDPHEAQEQQELKACLRWCRLQ
DEVRNSPEEMQVLR
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggacacaaagctggacccttcccgggatgacctacctctcatggccaacaccagccac
atacttgtgaagcactatgtactggatttagatgtggactttgaaagtcaaatcatcgag
ggcaccatagtgcttttctttgagtctggaaacagattccagaaacagagtgggtccacc
aaggaaccctgccgatcagagtcaaacgaagcctgcagatttaggatgcctgaaccctgc
catagtcctgtgacagatacaaggaccttctcctctaaaacaagatctaatgattttaca
atctgtggtaaaggtgaaaaagatacttctggtaaagatggtaaccatgacaactgggaa
caggcttctgggatttctagctcaaagtactgctgtgacacagggaatcatgggagtgag
gattttttgctagtgttggactgctgtgatttatctgtgttaaaggttgaggaggtggat
gttgctgctgtgccaggtattgaaaaattgacaaggtctcccaagctcacagttgtttct
gaggagctcaggaatcagattgtgtgtgaacttgtgactctgcctgcagatcgttggagg
gagcagttagactattatgctcgttgcagccaggctcctggctgtggggaactcctgttt
gacactgacacttggagcttgcagatcaggaagacaggggctcagacagctactgacttt
cctcacgccataaggatacggtacagcaccaaaccccaggggcgatcagttacctggacc
tcagaccagagtggcaggccatgtgtttatactatgggatctcccataaacaacagggcc
ctttttccctgccaggagccacccgttgccatgtcaacatggcaagctacagttcgagca
gctgcatcttttgttgttttaatgagtggggaaaattctgccaagccaacacagcttcgg
gaagggtgctcaagctggcattactatgtaaccatgccaatgccggcctccaccttcaca
atcgcagtgggatcctggacagaaatgaagccagagacctgctcatccaatgatctggca
gcagagagatctctgtcaccttccgaggctgacttcaggtatgttggcatttgtggtcac
atggaatacccctgccgcttccagaatccttctgccaccacccaggaaattattcctcat
cgggtctttgccccagtgtgcctcaaggctgcctgccaagagacccttctgcaactggtc
cctccttgcctctcagcagcacaccgtgtcctgggaacacacccgttctccaggctggac
atactcatcgtccccggcaattttccgagtctggggatggccagcccacacatcatcttc
ctctctcagagcgtcttgacgggaaacagccatctctgtgggacccgtctctgccatgaa
atcgctcacgcctggtttggcctagccatcggggcccgggactggacggaggagtggctg
agcgaagggttcgccactcacttggaagatgtgttctgggccaaagcacagcagctggac
ccccatgaggcccaggagcagcaggagctgaaggcttgtctacgctggtgtcgtctccag
gacgaggtgcggaactccccggaggagatgcaggtgttgaggtag

DBGET integrated database retrieval system