KEGG   Panthera pardus (leopard): 109253123Help
Entry
109253123         CDS       T06062                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00600  Sphingolipid metabolism
ppad01100  Metabolic pathways
ppad04020  Calcium signaling pathway
ppad04071  Sphingolipid signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04370  VEGF signaling pathway
ppad04371  Apelin signaling pathway
ppad04666  Fc gamma R-mediated phagocytosis
ppad05152  Tuberculosis
Module
ppad_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    109253123 (SPHK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109253123 (SPHK2)
   04371 Apelin signaling pathway
    109253123 (SPHK2)
   04020 Calcium signaling pathway
    109253123 (SPHK2)
   04072 Phospholipase D signaling pathway
    109253123 (SPHK2)
   04071 Sphingolipid signaling pathway
    109253123 (SPHK2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    109253123 (SPHK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109253123 (SPHK2)
Enzymes [BR:ppad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     109253123 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 109253123
NCBI-ProteinID: XP_019281345
Ensembl: ENSPPRG00000000381
Position
Unknown
AA seq 658 aa AA seqDB search
MNGHLETEEQGDQRPDQELTWSWGHRPRSALDGAKAMAPPPPPPLAASTPLLHGEFGSFP
ARSSRFALTLTPQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDAAAAYFCIY
TYPQGRRGGRRRAARTFRVDGAATYEENRAEAQRWATALMCLLRGLPLPGDGEITPELLP
KPPRLLLLVNPLGGRGLAWQWCKTHVLPMISEAGLSFNLIQTERQNHARELVQGLRLSEW
DGIVTVSGDGLLFEVLNGFLDRPDWEEAVKTPVGILPCGSGNALAGAVNQHGGFEPALGV
DLLLNCSLLLCRGGSRPLDLMSVTLASGSRCLSFLSVAWGFVSDVDIQSERFRALGSARF
TLGTVLGLATLHTYRGRLSYLPATVEPTSPTPARGLPRAKSELTLAPAPAPAPPVAHSPL
HRSVSDLPLPLPQPALTSPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPPLPSPPS
SPKAALLSPITEGVPETLASSGLPPPTPGSPGAVSTRGPHDHLLPPLGTPLPPGWVTLEG
DFVLMLAISPSHLGADLVAAPHARFDDGLVHLCWVRGGISRAALLRLFLAMERGSHFSLG
CPQLGYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGLGTLLTGPPGCPRREP
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacacctcgaaacagaggagcagggggatcagaggccagaccaggagctgacc
tggagctggggccacaggcctagaagcgccctggacggggccaaggccatggccccccca
ccgccgccaccattggccgccagcaccccgctcctgcatggcgagtttggctccttcccg
gcccgcagctcccgcttcgccctcactctcacaccacaggccctacacatacagcggctg
cgcccaaagcctgaagcccggccccggggcggcctggtcccgctggccgaggtgtccggc
tgctgcaccctgcggagccgcagcccctcggacgcagcagcggcctacttctgcatctac
acctatccgcagggccggcgcgggggccggcgcagagccgcccgcacctttcgggtcgac
ggggcggccacctacgaggagaaccgcgctgaggcccagcgctgggccactgccctcatg
tgtctgctccgtggactgccgctgcctggggacggggaaataacccccgagcttctgcca
aagccaccccgattgctcctattggtcaatccccttgggggacggggcctggcctggcag
tggtgtaagacccacgtgctgcccatgatctccgaagctgggctgtccttcaacctcatc
cagacagaacgacagaaccatgcccgggagctggttcaggggctgaggctgagtgagtgg
gacggcattgtcacggtctccggagacgggctgctgtttgaggtgctgaacggattcctg
gaccgccctgactgggaagaggctgtgaagacgcccgtgggcatcctcccctgtggctca
ggcaatgccttggccggagctgtgaaccagcatggggggtttgaacctgccctgggtgtg
gacctgctgctcaattgctcgctgctactctgccggggcggcagccgcccgctggacctg
atgtctgtgacgctggcctccggctcccgctgcttgtccttcctgtctgtggcctggggc
ttcgtgtcagacgtggatatccagagcgagcgcttcagggccctgggcagtgcccgcttc
acactgggcacagtgctgggcctcgccacactgcacacctaccgaggacgcctctcctac
ctccctgccaccgtggagcccacctcacccacccctgcccgtggcctgccccgtgccaag
tcagagctgaccctggccccggccccggccccggccccacctgtggcacactcacccctg
catcgttcagtgtctgacctgcccctgcccctgccccagcccgccctgacctcccctggc
tcgcctgaacccctgcccatcctgtccctcaatggcgggggcccagagttggccggggac
tggggtggggctggggatgcccccctgtccccagacccaccactgccctcaccgcctagc
tcccctaaggcagctttactgtcacccatcaccgagggggtcccagaaacgttggcatcc
tctgggcttccccctcccacccccggctctccgggagccgtctctaccaggggcccgcat
gaccacctgctccctcctctgggcaccccactccccccaggctgggtgacgctggagggg
gactttgtgctcatgctggccatctcacctagccacctgggggcagacctggtggcagct
ccccacgcgcgctttgacgacggcctggtgcacctgtgctgggtgcgtggtggcatctcc
cgggctgcgctgctacgcctctttctggccatggagcgaggtagccacttcagcctgggc
tgtccgcagctgggctacgccgcggcccgtgccttccgcctcgagcctctcacgcctcgg
ggcgtgctcactgtggacggagagcaggtggagtacgggccactgcaggcgcagatgcac
ccgggcctcggcacgctgctcactgggcctcccggctgcccgcgtcgggagccttga

DBGET integrated database retrieval system