KEGG   Panthera pardus (leopard): 109254164Help
Entry
109254164         CDS       T06062                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04010  MAPK signaling pathway
ppad04014  Ras signaling pathway
ppad04015  Rap1 signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04066  HIF-1 signaling pathway
ppad04068  FoxO signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04150  mTOR signaling pathway
ppad04151  PI3K-Akt signaling pathway
ppad04152  AMPK signaling pathway
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04520  Adherens junction
ppad04910  Insulin signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04923  Regulation of lipolysis in adipocytes
ppad04930  Type II diabetes mellitus
ppad04931  Insulin resistance
ppad04932  Non-alcoholic fatty liver disease (NAFLD)
ppad04960  Aldosterone-regulated sodium reabsorption
ppad05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109254164 (INSR)
   04015 Rap1 signaling pathway
    109254164 (INSR)
   04010 MAPK signaling pathway
    109254164 (INSR)
   04066 HIF-1 signaling pathway
    109254164 (INSR)
   04068 FoxO signaling pathway
    109254164 (INSR)
   04072 Phospholipase D signaling pathway
    109254164 (INSR)
   04022 cGMP-PKG signaling pathway
    109254164 (INSR)
   04151 PI3K-Akt signaling pathway
    109254164 (INSR)
   04152 AMPK signaling pathway
    109254164 (INSR)
   04150 mTOR signaling pathway
    109254164 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109254164 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109254164 (INSR)
   04923 Regulation of lipolysis in adipocytes
    109254164 (INSR)
   04913 Ovarian steroidogenesis
    109254164 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109254164 (INSR)
  09149 Aging
   04211 Longevity regulating pathway
    109254164 (INSR)
   04213 Longevity regulating pathway - multiple species
    109254164 (INSR)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109254164 (INSR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109254164 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109254164 (INSR)
   04931 Insulin resistance
    109254164 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppad01001]
    109254164 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ppad04090]
    109254164 (INSR)
Enzymes [BR:ppad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109254164 (INSR)
Protein kinases [BR:ppad01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   109254164 (INSR)
CD molecules [BR:ppad04090]
 Proteins
  109254164 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 Kinase-like B2 DUF4476 MVL
Motif
Other DBs
NCBI-GeneID: 109254164
NCBI-ProteinID: XP_019283392
Ensembl: ENSPPRG00000009528
Position
Unknown
AA seq 1344 aa AA seqDB search
MDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLVMITDYLLLFRVYGLE
SLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYSLMNITRGSVRIEKNNELCYLAT
IDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQK
VCPTICKSHGCTADGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQD
WRCVNFSFCRDLHNKCKNSRRQGCHQYVIHNNRCIPECPSGYTMNSSNLMCTPCLGPCPK
VCHILEGEKTIDSVTSAQELRGCTVVNGSLIINIRGGNNLAAELEANLGLIEEISGYLKI
RRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHY
NPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWE
PYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPG
WLMRGLKPWTQYAVFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQ
IILKWKPPSDPNGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKH
NQSEYEESAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKSFSSPGAEDSRP
SRKRRALADAGNVTAAVPTVPGFPNTSGSVPTSPEEHKPFEKVVNKESLVISGLRHFTGY
RIELQACNQDAPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPN
GLIVLYEVSYRRYGDEELHLCVSRRHFALERGCRLRGLPPGNYSVRVRATSLAGNGSWTE
ATYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPE
YLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKT
VNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMVHGDLKSYLRSL
RPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDF
GMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQ
GLSNEQVLKFVMDGGYLDQPDNCPERVTDLMHMCWQFNPKMRPTFLEIVDLLKDDLHPSF
PEVSFFHSEENKAPESEELEMEFEDMESVPLDRASHSQREEAGGRDGVSSLGLKRNYEDH
IPYTHMNGGKKNGRILTLPRSNPS
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atggatatccggaacaacctgacgaggctgcacgaactggccaactgctcggtcattgaa
ggtcatttgcagatactgctcatgttcaaaacgaggcccgaggacttccgagacctcagt
ttccccaaactcgtcatgatcactgattacttgctgctctttcgggtgtacgggctggag
agcctgaaggacctcttccccaacctcacggtcatccggggctcgcgcctcttcttcaac
tacgcgctggtcatcttcgagatggtgcacctgaaggagcttggcctctacagcttgatg
aacattacccggggctccgtccgcatcgagaagaacaatgagctgtgctacctggccacc
atcgactggtcacgcatcctggattcggtggaggataattacattgtgttgaacaaagac
gacaacgaggagtgtggggacatttgtccaggcaccgcaaagggcaagaccaactgccct
gccactgtcatcaacgggcagtttgtggagcgatgttggacacacagccattgccagaaa
gtttgtccgaccatctgcaagtcgcacggctgcacggccgacggcctctgctgccacagc
gagtgtctgggcaactgctccgagcccgacgaccccaccaagtgcgtggcctgtcgcaac
ttctacctggacggcaggtgcgtggagacctgcccgcccccctactaccacttccaagac
tggcgctgcgtgaacttcagcttctgccgggacctgcacaataaatgcaagaactcccgg
agacagggttgccaccagtatgtcattcacaacaacaggtgcatccctgagtgcccctcg
gggtacacgatgaattccagcaacctgatgtgtactccctgcctgggcccctgtcccaag
gtctgccacatcctggaaggcgagaagaccatcgactcggtgacatctgcccaggagctc
cgaggctgcaccgtcgtcaacggaagcctaatcatcaacattcgagggggcaacaacctg
gcagctgagctggaggccaacctcggactcattgaagaaatttctgggtacctgaagatc
cgaaggtcctatgctcttgtgtcactttcctttttccggaagttacggctgattcgggga
gagaccttggaaatcgggaactactctttctatgccttggacaaccagaacctgaggcag
ctatgggactggagcaaacacaacctcaccatcactcaggggaaactcttcttccactat
aatcccaaactctgcttgtcggaaattcacaagatggaggaggtttcaggaaccaagggg
cgccaggagcggaacgacattgccctgaagaccaatggggaccaggcgtcttgtgaaaat
gaactacttaaattttcttacattcggacatcttacgacaagatcttgctgaaatgggag
ccgtactggccccctgacttccgagacctcctgggcttcatgctcttctacaaagaggcc
ccttatcagaatgtgaccgagttcgacgggcaggacgcgtgtggctccaacagctggacg
gtggtggacattgacccgcctctgaggtccaatgaccccaagtcgcagaaccacccaggg
tggctgatgcggggtctcaagccctggacccagtatgctgtctttgtcaagaccttggtc
accttttctgatgagcgccgcacgtatggggccaagagtgacatcatctatgtccagacc
gatgccaccaacccttccgtccccctggatcctatctcggtttcgaattcctcctctcag
atcattctgaagtggaagcctccctcggaccccaatggcaacatcacgcactacctggtg
ttctgggagaggcaggcggaggacagtgagctgtatgagttggattattgcctcaaaggg
ttgaagctgccttcccggacctggtccccgccgttcgagtccgagggctcccagaagcac
aatcagagtgagtacgaggagtccgctggcgaatgctgctcgtgtcccaagaccgactct
cagatcctgaaggagctggaggagtcctctttcaggaagacgttcgaggattacctgcac
aatgtggttttcgtgcccagaaaatccttttcaagccctggtgctgaggacagtaggccg
tcgcggaagcgcagggccctcgccgacgctgggaacgtgaccgccgccgtgcccacggtg
cctggtttccccaacacttccggcagcgtgcccacgagcccggaagagcacaagcccttc
gagaaggtggtgaacaaagagtctctggtcatctccggcctgcgtcacttcactggctac
cgcatcgagctgcaggcttgcaaccaagatgcccccgaggagaggtgcagcgtggccgcc
tacgtcagcgccaggaccatgcccgaagccaaggcagacgacattgttggccctgtgacc
catgaaatcttcgagaacaacgtggttcacttgatgtggcaagagcctaaagaacccaat
ggattgatcgtgctgtatgaagtgagttaccgacggtatggtgatgaggagctgcacctc
tgtgtctcccgtagacactttgctctggagcggggctgcaggctgcgagggctgccgccg
gggaattacagtgtgcgagttcgggccacctccctggcgggcaacggctcctggacagaa
gccacttatttctatgtgacagactatttagatgtcccatcgaacattgcaaaaattatc
atcgggcctctcatctttgtctttctcttcagtgttgtgattggaagtatttatctattc
ctgagaaagaggcagccggatgggccactggggccgctgtatgcttcttcaaaccctgag
tacctcagtgccagtgatgtgtttccctgctctgtgtatgtgccggacgagtgggaggtg
cctcgggagaagatcactctcctgcgcgagctggggcagggctccttcggcatggtgtac
gagggcaatgccagggacatcgtcaagggcgaggcggagacccgcgtggcggtgaagacg
gtcaacgagtccgccagtctgcgagagaggatcgagtttctcaacgaggcctcagtcatg
aagggcttcacctgtcatcacgtggtccgcctcctgggggtggtgtccaaaggccagccg
acgctggtggtgatggagctgatggttcacggagacctgaagagctacctccgctccctg
cggccggaggctgagaataaccctggccgccctccccctactctgcaagagatgattcag
atggcggcggagatcgccgacgggatggcgtacctgaatgccaagaagtttgtgcaccgg
gatctcgcagctcgaaattgcatggtggcccacgacttcaccgtcaaaattggagacttc
ggaatgaccagagacatctatgaaacggattactaccggaaaggaggcaagggtctgctc
cccgtgcggtggatggcaccggaatccctgaaggacggggtcttcaccacttcttctgac
atgtggtcctttggtgtggtcctttgggaaatcaccagcttggcggaacaaccttaccaa
ggcctgtctaatgaacaggtgttgaaatttgtcatggacggaggatatttggaccaacct
gacaactgtccggagagagtcaccgacctgatgcacatgtgctggcagttcaatcccaag
atgcggcccaccttcctggagatcgttgacctgctcaaggacgacctgcaccccagcttt
ccggaagtttccttcttccacagcgaggagaacaaggcgcctgagagtgaggagttggaa
atggagtttgaggacatggagagtgtccccctggatcgggcctcacactcacagagggaa
gaggccgggggccgggatggagtgtcctcgctgggcctcaagcggaactacgaggaccac
atcccctacacccacatgaacgggggcaagaaaaacggacggattctgaccctgccgagg
tcgaatccttcctaa

DBGET integrated database retrieval system