KEGG   Panthera pardus (leopard): 109254719
Entry
109254719         CDS       T06062                                 

Gene name
LNPEP
Definition
(RefSeq) leucyl-cystinyl aminopeptidase isoform X1
  KO
K01257  cystinyl aminopeptidase [EC:3.4.11.3]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    109254719 (LNPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109254719 (LNPEP)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.3  cystinyl aminopeptidase
     109254719 (LNPEP)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109254719 (LNPEP)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N pP_pnuc_1 Paramyxo_C Dynactin
Other DBs
NCBI-GeneID: 109254719
NCBI-ProteinID: XP_019284409
Ensembl: ENSPPRG00000001253
Position
Unknown
AA seq 1012 aa
MIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGEHEMDEDEEDYESSA
KLLGMSFMNRSSGLRNSATGYRPSPDGTCSVPSARTMAICVFLIVVAVSIIMVIYLLPRC
TFTKEGCHKKNQSMGLIQPVATNGKLFPWAQVRLPTAIMPLRYELNLHPNLTSMTFRGSV
TISLQALQATWNIVLHSTGHNISRVTFMSAVSSQEKQVEVLEYPFHEQIAIVAPEALLEG
HNYTLKIEYSANISTSYCGFYGISYTDESNEKKYFAATQFEPLAARSAFPCFDEPGFKAT
FIIRIIRDEQYTALSNMPKNSSIIMEDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVN
GTLVSIYAVPEKIGQVHHALETTVKLLEFYQNYFEIQYPLKKLDLVAIPDFEAGAMENWG
LLTFREETLLYDNNTSSVADRKLVTKIIAHELSHQWFGNLVTMEWWNDLWLNEGFATFME
YFSLEKIFKELSSYEDFLDARFKTLKKDSLNSSHPISSSSVQSSEQIEEMFDSLSYFKGA
SLLLMLKTYLSEDVFQNAVVFYLHSHSYASIKSDDLWDSFNEVTNKTLDVKKMMKTWTLQ
KGFPLVTVQRKGKDLHVQQERYFLNVKPEIQPSDASYLWHIPLSYVTEGRNYSKYPLVFL
LDKKSGVINLTEEVQWIKVNTNMNGYYIVHYADDDWEALIKQLKTNPYVLSDKDRANLIN
NIFELAGLGKVSLQRAFDLIDYLGNETYTAPITEALFQTGLIYNLLEKLGHMDLASRVVA
RVFKLLQSQIQQQTWTDESTPSTRELRSVLLEFACTHGLENCSTVAMKLFDDWVASNGTQ
SLPTDVMTTVFKVGAQTEKGWSFLLSKYVSIGSEAEKNKILEALASSEDVRKLYWLMKKS
LSGDIIRTQKLSFIIRTAGRHFPGHLLAWDFVKENWNKLVQKFHLGSYTIQSIVAGSTHL
FSTKAHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIRWMEKNLKTLTWWL
NT seq 3039 nt   +upstreamnt  +downstreamnt
atgattgaaaacagcatgtttgaggaagaaccagatgtggtggatttagccaaagagccc
tgtttacatcctctagagcctgatgaggtggaatatgagccccggggttcaagactgctg
gtgcggggtcttggtgagcatgagatggatgaggacgaagaggattatgagtcatctgca
aaactgctgggcatgtccttcatgaacagaagctcaggccttcggaacagtgcaactggc
tacaggccgagcccagatgggacttgttcggtaccctctgcgaggaccatggcgatctgt
gtttttcttattgtggttgccgtttctataatcatggtgatttatttactacccagatgt
acttttaccaaagaaggctgccataaaaaaaaccaatcaatgggactaattcagccagtt
gcgacaaatggaaagttgtttccgtgggcacaagtcaggcttcccaccgccattatgcca
ctacgctatgaacttaacctacacccaaacctaacctcgatgacattcaggggttctgtg
acaatttcacttcaggctcttcaggccacgtggaatatcgttcttcacagtacaggccat
aatatttcaagagtgacctttatgtcagcagtttcaagccaagaaaaacaagttgaggtc
ttggaatacccatttcatgaacaaattgcaattgttgcccctgaagctcttcttgaagga
cacaattataccttgaagatagagtattcggcaaatatatctacttcttactgtgggttc
tatggaatctcctatacagatgaaagtaatgagaaaaagtactttgcagcaactcagttt
gaacccctggcagcaagatctgcttttccttgttttgatgaaccaggatttaaagccaca
tttatcatcaggatcataagggatgagcaatatactgctttatcaaatatgcctaagaat
tcatcaatcattatggaagatggacttgttcaggatgagttttctgagagtgtgaaaatg
agcacttacctggttgcattcattgttggggagatgaagaacctgagtcaggacgtaaat
ggaaccctggtttctatatatgctgtaccagaaaagattggtcaagttcaccatgccttg
gaaacaactgtgaagcttcttgaattctatcaaaactactttgaaattcaatacccactt
aagaaattggatttggtggctattcctgactttgaagcgggagcaatggaaaattggggt
ttgctcaccttccgtgaagagacacttctgtatgacaataatacttcttcagtggcggat
agaaaactggtgactaaaatcattgctcatgagctctcccatcagtggtttggtaatcta
gtaacaatggagtggtggaacgatctatggctaaatgaagggtttgctactttcatggag
tatttctccttggaaaaaatattcaaagagctttctagttatgaagatttcttagatgct
cgatttaaaaccctgaagaaagattccttgaattcatctcatccaatatcatcatcatct
gttcagtcttcagaacagatcgaagaaatgtttgattctctttcctattttaagggagcc
tctctcttgttgatgctgaaaacttatcttagtgaggatgtattccaaaatgctgttgtc
ttttacctgcatagtcatagctatgcatccattaaaagtgatgatctgtgggatagtttt
aatgaggtcacaaacaaaacactagatgtaaagaaaatgatgaaaacctggaccctgcaa
aaaggatttcctttagtgactgtccaaagaaaaggaaaggaccttcatgtacaacaagaa
agatactttttaaatgtgaagcctgaaattcagccttcagatgcaagctatctctggcat
attccactatcctatgtcactgagggaagaaattactcaaaatatccattggtattttta
ctggacaagaaatcaggtgtcatcaatcttacagaagaagtgcagtggatcaaagtcaat
acaaacatgaatggctattacattgtacactatgcagatgatgactgggaagcactgatc
aaacagttgaaaacaaatccttatgtcctgagtgacaaagaccgagccaacctcatcaac
aacatctttgaacttgcaggcctaggcaaggtgtctcttcaaagggcctttgatttgatt
gattaccttggaaatgagacctataccgcccccatcactgaagccctgttccagacaggc
ctcatctataacctccttgaaaagctgggacacatggatctggcctcaagagtagtggcc
agggtatttaagttacttcaaagtcaaatccaacagcaaacttggactgatgaaagcacc
ccatctactcgagagcttcggtcagtcctgttagaatttgcttgcacccacggcctagag
aactgcagcactgttgccatgaagctctttgatgattgggtggcatctaatggaactcaa
agcctacctactgatgtcatgactactgtgttcaaggttggagcacaaactgagaaaggc
tggtcattcctactaagcaagtatgtctctataggctctgaagcagaaaagaataaaata
cttgaggctcttgccagctccgaggatgtacggaaactttactggttaatgaaaaagagc
ctcagtggagatatcatccgaacgcagaagctgtcatttatcattagaacagctggccga
cattttcctgggcacttgctggcatgggattttgtcaaagagaactggaataagcttgtg
cagaagtttcatctggggtcctataccatacaaagtattgttgccgggtcaacacacctg
ttttcaacaaaggcacatttgtctgaggtccaggcgttctttgaaaatcagtcagaggca
acctttcggcttcgttgtgtccaggaggccttggaagtcattcagttgaatatccgatgg
atggagaagaaccttaaaactctgacgtggtggctgtag

DBGET integrated database retrieval system