KEGG   Panthera pardus (leopard): 109254724
Entry
109254724         CDS       T06062                                 

Gene name
ERAP2
Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmic reticulum aminopeptidase 2
  KO
K13723  endoplasmic reticulum aminopeptidase 2 [EC:3.4.11.-]
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109254724 (ERAP2)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109254724 (ERAP2)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109254724 (ERAP2)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N SapB_1 MSP7_C
Other DBs
NCBI-GeneID: 109254724
NCBI-ProteinID: XP_019284419
Position
Unknown
AA seq 901 aa
MAKSCRKLIFNIYMGFYCPTIIPKICICSHFSMPSIDQFNKGPRAXVVTNGEPFLWNELR
FPSIVITLHYDXVHPNLTSLGFITSEKXLVRDAALYIILHSKDLEIMNIILRSEEDLRHR
KPGKKLNVLSFAAHQQIALLALEKLMADLSXPMAIDLXAKSASGFKGLYKSTYRACRGKT
RIIAVMDFEPTHSRLVFPCFHEPLYVSNFSITIRRERGHICQRPGGLLEDHFETTVKMRT
YLIAYIVCDFNSVSGTTLSGVKVSVYTSAGEWSKKHYALEASLKLLDFYDHYFGINYPLP
KLDLVAIPDFESGAMENWGLITYQKTSLLFDPKTSSASDRLWVTKVIAHELAHQWFGNLV
TMKXWNDIWFNEGFATYMELISLNATYPKLXFDDAFLDVCFGVIEQDSXNSSFPISNQAE
TPIXIQEMFNAVSYEKGACISNILKDLLSKEKFQEGIIHYLKKFSYGNAKNDDLWSSLSN
SCLGNFTSGGFCYSGSKMTSCTLAFLGEDVEVKEMMTTWTLQRGIPLIVIGQKGRSLRLQ
XIGFLSRVFKDDPEWRALQERYLWHIPLTYSTXSSNAIHGHILKSRTDTLDLSETTXXVS
VDSNGYYIVHYEGHGWDQLMEPTLLHQNHTLRKPKDRVGLIHDAFQLVNFSKISYDFIHY
LLXYFKPVIDMQSWSKEGSVWDRLLALTILKQASYLNHASCIQKATELFSQWMEFSGKLN
ILTDVLKIVYSVGAQTAVGWNYLLEQYGLSLSGAEKTKILCALSTSKHQEKLMKXVHXFK
LLIELRMGGKVIKTQELVPLPHAISRNPKGQQLAWKFLREIWTHLLEKFXLGSFAMRVII
SGTTFHSSSKELQEVKLFFESLKAQGRYLGTFQIILEAISKNIKWLKKNLPTLRTWLLVS
I
NT seq 2706 nt   +upstreamnt  +downstreamnt
atggccaaatcatgcagaaaactaatatttaatatttatatgggattttactgtccaaca
atcatacccaaaatatgcatttgttctcatttttcaatgccatctattgatcagttcaat
aagggccctagggctntagtagtcaccaacggggaaccatttctttggaatgagctaagg
ttccccagcattgtcattacccttcactatgatntggtccatccaaatcttacctccctg
ggctttatcacatctgagaagnnattggtcagagatgccgcactatatatcatcttgcac
agcaaagatcttgaaatcatgaatatcatccttcgatcagaggaagatttgagacacagg
aaaccaggaaaaaagctgaatgttttgagttttgctgctcatcaacaaattgcacttctg
gctctagagaaactcatggctgacttgagttaacctatggccattgacctctaggccaag
tcagccagtggtttcaaagggctttataaaagcacatacagagcttgtcgtggtaaaaca
agaataattgcagtaatggattttgagccaacccattcacggttggtttttccttgcttt
catgaaccactgtatgtatccaacttttcaatcacaataagaagagaaagaggacacata
tgccaaaggccaggaggcctcttagaagatcattttgaaactacggtaaaaatgaggaca
tatcttatagcctacatagtttgtgatttcaactctgtgagtggcacaaccttgtcaggg
gtcaaggtgtctgtgtacacatccgcaggcgaatggagtaaaaaacattatgccttggaa
gcatcactaaagctccttgatttttatgaccattactttggtatcaactatccactcccc
aaactggatctagttgccattcctgactttgaatctggagccatggaaaattggggcctc
atcacatatcaaaaaacatcactgctctttgatcccaagacctcttctgcttctgataga
ctgtgggtcaccaaagtcatagcccatgaactagcacaccagtggtttggcaacctggtt
acaatgaaatgatggaatgatatttggttcaatgaaggttttgcaacatacatggaactc
atctcacttaatgctacatatccaaagctataatttgatgatgcttttttggatgtttgt
tttggagtgattgaacaagattcatgaaattcatcctttcctatctccaatcaggcagaa
actcctatttaaatacaggaaatgtttaatgcagtttcctatgagaagggagcttgtatt
tcaaatattctcaaggatctcctgagtaaggagaaattccaggaaggaattattcactac
ttaaagaagttcagttatggaaatgccaaaaatgatgatttgtggagcagtttgtcaaat
agttgtttaggtaattttacatctggtggattttgttattctggttccaagatgacaagc
tgcacacttgcctttctgggggaagatgtggaggtcaaggagatgatgactacgtggact
ctgcagagaggaattcccctcattgtgattggacaaaaaggacgttcactcaggctccaa
tagataggttttctgagcagggttttcaaagatgacccagaatggagggccctacaggaa
aggtatctttggcatattccattgacctactccacanattcctctaatgcaattcatgga
cacattctaaaatcaaggacagatactctggatttatctgaaactacancttgagtcagt
gtggactcaaatggctactacattgttcactatgaggggcatggatgggaccaactcatg
gaaccaactctactgcatcagaaccacacgcttcgcaaacctaaggacagagtaggtctg
attcatgatgcatttcagctggtaaatttcagcaaaatttcatatgatttcatacattac
cttctttgatattttaagccggtgattgacatgcaaagctggagcaaggagggctcagtc
tgggacaggttgcttgccttgaccatcttaaaacaggcctcttacctgaaccatgcttcc
tgcatccagaaggcaactgaactcttctctcagtggatggaattcagtggaaaattaaac
attctaacagatgttttaaagatcgtatattccgtgggtgctcaaacggcagtaggatgg
aattaccttttagagcaatatggattgtcactttcaggtgctgaaaaaaccaaaattctg
tgtgcattgtcaaccagcaaacatcaggaaaagttaatgaaataagtgcactaatttaaa
ttattaattgaactaagaatgggtggaaaggtcatcaagacacaggagttggtgcctctt
cctcatgcaatctccagaaatccaaagggacagcaattagcctggaaatttttaagagaa
atttggacccatctccttgaaaagttttgactaggctcatttgccatgagagtgatcatc
tctggaacaacatttcactcctcttccaaggagttacaagaggtgaaactgttctttgaa
tctcttaaggcccaaggacgatatctaggtacttttcaaattattctggaagccatatcc
aaaaatatcaagtggctgaagaagaatcttcccactctgaggacttggctactggttagt
atttaa

DBGET integrated database retrieval system