KEGG   Panthera pardus (leopard): 109254969
Entry
109254969         CDS       T06062                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad01100  Metabolic pathways
ppad01522  Endocrine resistance
ppad04015  Rap1 signaling pathway
ppad04020  Calcium signaling pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04062  Chemokine signaling pathway
ppad04072  Phospholipase D signaling pathway
ppad04114  Oocyte meiosis
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04270  Vascular smooth muscle contraction
ppad04371  Apelin signaling pathway
ppad04540  Gap junction
ppad04611  Platelet activation
ppad04713  Circadian entrainment
ppad04714  Thermogenesis
ppad04723  Retrograde endocannabinoid signaling
ppad04724  Glutamatergic synapse
ppad04725  Cholinergic synapse
ppad04727  GABAergic synapse
ppad04742  Taste transduction
ppad04750  Inflammatory mediator regulation of TRP channels
ppad04911  Insulin secretion
ppad04912  GnRH signaling pathway
ppad04913  Ovarian steroidogenesis
ppad04914  Progesterone-mediated oocyte maturation
ppad04915  Estrogen signaling pathway
ppad04916  Melanogenesis
ppad04918  Thyroid hormone synthesis
ppad04921  Oxytocin signaling pathway
ppad04923  Regulation of lipolysis in adipocytes
ppad04925  Aldosterone synthesis and secretion
ppad04926  Relaxin signaling pathway
ppad04927  Cortisol synthesis and secretion
ppad04928  Parathyroid hormone synthesis, secretion and action
ppad04934  Cushing syndrome
ppad04935  Growth hormone synthesis, secretion and action
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04976  Bile secretion
ppad05032  Morphine addiction
ppad05163  Human cytomegalovirus infection
ppad05166  Human T-cell leukemia virus 1 infection
ppad05200  Pathways in cancer
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109254969 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109254969 (ADCY4)
   04371 Apelin signaling pathway
    109254969 (ADCY4)
   04020 Calcium signaling pathway
    109254969 (ADCY4)
   04072 Phospholipase D signaling pathway
    109254969 (ADCY4)
   04024 cAMP signaling pathway
    109254969 (ADCY4)
   04022 cGMP-PKG signaling pathway
    109254969 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109254969 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109254969 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109254969 (ADCY4)
   04062 Chemokine signaling pathway
    109254969 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    109254969 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    109254969 (ADCY4)
   04912 GnRH signaling pathway
    109254969 (ADCY4)
   04913 Ovarian steroidogenesis
    109254969 (ADCY4)
   04915 Estrogen signaling pathway
    109254969 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    109254969 (ADCY4)
   04921 Oxytocin signaling pathway
    109254969 (ADCY4)
   04926 Relaxin signaling pathway
    109254969 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    109254969 (ADCY4)
   04918 Thyroid hormone synthesis
    109254969 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    109254969 (ADCY4)
   04916 Melanogenesis
    109254969 (ADCY4)
   04925 Aldosterone synthesis and secretion
    109254969 (ADCY4)
   04927 Cortisol synthesis and secretion
    109254969 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109254969 (ADCY4)
   04270 Vascular smooth muscle contraction
    109254969 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    109254969 (ADCY4)
   04971 Gastric acid secretion
    109254969 (ADCY4)
   04972 Pancreatic secretion
    109254969 (ADCY4)
   04976 Bile secretion
    109254969 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    109254969 (ADCY4)
   04727 GABAergic synapse
    109254969 (ADCY4)
   04725 Cholinergic synapse
    109254969 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    109254969 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    109254969 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    109254969 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    109254969 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    109254969 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109254969 (ADCY4)
   04714 Thermogenesis
    109254969 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109254969 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    109254969 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    109254969 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109254969 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109254969 (ADCY4)
   05163 Human cytomegalovirus infection
    109254969 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109254969 (ADCY4)
Enzymes [BR:ppad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109254969 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 109254969
NCBI-ProteinID: XP_019284830
Ensembl: ENSPPRG00000019543
Position
Unknown
AA seq 1081 aa
MVQPDTNGKSRCPVSFCYLSLRHISEVAWGGCLFFFSLEAVPHTPHSSLAASTLSSQELA
SDPGFLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWAALLGLGHGFLFTGGLVSA
WDQVSFFLFVIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSKPALLPQLAA
NAVLFLCGNVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLA
REMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVL
MLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLR
AATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLA
LLAGAYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSL
LMTRYLESWGAAKPFAHLSHLESPVSTSTPLPEKALASFGPQWSLDRSRTPRGLDDDLDT
GDAKFFQVIEQLNSQKQWRQSKDFNPLTLYFRKKELEKEYRLSALPAFKYYAACTFLVFL
SNFIIQMLVTNRPPALAITYSITFLLFLLLLFVCFSEHLTRCVLKGPKTLHWLPALSGLV
ATRPGLRVALGTATILLVFVMAIPSLFFLPAASNCPFGALNVSSMAFNISWELPGSLPLI
SVPYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLGASCSLFLHSHAWLSDCLIARLYPD
PSDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMEN
LTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGL
ECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHL
GTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASR
MESTGVLGKIQVTEETARVLQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLARTGPPSATL
G
NT seq 3246 nt   +upstreamnt  +downstreamnt
atggttcaacctgatacgaatggcaagtcgaggtgccctgtctccttttgctacttgagt
ttgagacacatttcagaagtggcctgggggggctgcctgttcttcttcagcttggaggcg
gtcccccatactccacactccagtcttgctgcaagcaccctctcctcgcaggagctagct
tcagacccaggcttcctgaccactgtgctgtgcgcgctgggtggcttctcgctgctcctg
ggcctggcttcccgggagcaacgactgcagcgctggacacgtcccctgtcgggcctcgta
tgggcagcgctactcgggctaggccacggcttcctgttcactgggggcctggtgagcgcc
tgggaccaggtgtcctttttcctctttgtcatcttcaccgtgtacgccatgttgcccttg
ggcatgcgggatgccgctgctgcgggccttgcctcatcgctctcccacttgctggtcctg
gggctgtaccttgggcctcagccggactcaaagcctgcgctgctgccacagctggcagcg
aacgcggtgttgttcctgtgcgggaacgtggcgggagcgtatcacaaggcgctgatggag
cgcgcgctgcgcgccacgttccgcgaggcacttagctccctgcactcgcgccggcggctg
gacaccgaaaagaagcaccaggaacaccttctcttgtccatccttcctgcctacttggcc
cgagagatgaaggcagagatcatggcacgactgcaggctggacaggggtcacggccagaa
agcaccaacaacttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtac
gctgacatcgtgggcttcacccggctggccagtgagtgctctcctaaggagttggtgctc
atgctcaacgagctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcgg
atcaagatcctgggagactgttactactgtgtctctgggctaccgctctccctgccagac
cacgccatcaactgcgtgcgcatggggctggacatgtgccgggccatcaggaagctccgg
gcagccactggcgtggacatcaacatgcgtgtgggcgtgcattcgggcagtgtgctctgc
ggagtcattgggctgcagaagtggcagtatgatgtctggtcccatgatgtcacactggcc
aaccacatggaggcgggtggcgtgccaggacgagtacatattacaggggctaccctggcc
ctgctggcaggggcttatgctgtggaggatgcagccatggaacaccgggacccatacctt
cgggagctaggggagcctacctacctagtcatcgatccccgggctgaggaagaggatgag
aagggcactgcaggagggttgctgtcctctcttgagggccccaagatgcgtccgtcactg
ctgatgacccgctacctggagtcctggggcgccgccaagccttttgcccatctgagccac
ctagagagccctgtgtccacttctacccctctcccggagaaggccctggcttcctttggc
ccccagtggagcctggaccggagccgtaccccccgggggctagatgatgacctggacact
ggggacgccaagttcttccaggtcatcgaacagctcaactctcagaaacagtggaggcag
tcaaaggacttcaacccactgacactgtacttcagaaagaaggaactggagaaagagtac
cgactctctgcactccccgccttcaaatactatgcagcctgcaccttcctggttttcctt
tccaatttcatcatccagatgctggtgacaaacaggcccccagctctggccatcacctat
agcatcaccttcctcctcttcctcctcctcctcttcgtctgcttctcagagcacctgacg
aggtgtgtcttgaaaggccccaagacgctgcactggctgccggcactgtctggcttggtg
gccacacggcccggactgcgagttgcccttggcacagctaccatcctcctggtttttgtg
atggccattcccagcctgttcttcttaccagcagcatcaaactgcccttttggggctctc
aatgtgtcctccatggctttcaacatctcctgggagctccctgggtccctgcctctcatc
agcgtcccttactctatgcactgctgcgtgctggggttcctgtcctgctccctctttttg
cacatgagcttcgagctgaagttgctgctgctcctgctatggctgggggcctcctgctcc
ctcttcctgcactcccacgcctggctgtccgactgcctcatcgcccgcctctatccggat
ccctcggactccaggccaggggtgctgaaggagcccaaactgatgggagctatctccttc
ttcatcttcttcttcaccctccttgtcctggctcggcagaatgagtattactgccggctg
gacttcctgtggaagaagaagctgcggcaggagcaggaggagacagagaccatggagaac
ctgactcggctgctgttggagaatgtgctccctgcacatgtggccccccagttcattggc
cagaaccggcgcaacgaggacctctaccaccagtcctatgagtgtgtctgtgtcctgttc
gcctcagttccagacttcaaggagttttactctgagtccaacataaaccacgagggtcta
gagtgtctgcggctgctcaatgagataattgctgattttgatgagctgctctcaaagccc
aagtttagcggggtggagaagatcaaaaccatcggtagcacctacatggcagctacaggc
ttaaatgccacctccggacaggacgcacagcaggatgctgagcgcagctgcagccacctt
ggcaccatggtggagtttgcggtggctcttggatcaaagctggacgtcatcaataagcac
tctttcaacaacttccgcttgcgtgtggggttgaaccacggacctgtagtggctggagtg
atcggggcccagaagccgcagtatgacatctggggcaacacagtgaacgtggccagccgc
atggagagtacaggagtcctgggcaagatccaggtgactgaagagacagcccgggtgctg
cagtccttaggctacacctgctacagccggggtatcatcaaggtcaaaggcaaagggcaa
ctctgcacctactttctgaacacagatttggcacgaactggacctccctcggccacccta
ggctga

DBGET integrated database retrieval system