KEGG   Panthera pardus (leopard): 109254974Help
Entry
109254974         CDS       T06062                                 

Gene name
LTB4R
Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109254974 (LTB4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ppad04030]
    109254974 (LTB4R)
G protein-coupled receptors [BR:ppad04030]
 Rhodopsin family
  Lipid
   Leukotriene
    109254974 (LTB4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 109254974
NCBI-ProteinID: XP_019284854
Position
Unknown
AA seq 332 aa AA seqDB search
MFIALLTIILLSVALVVGLPGNSFVVWSILVKMQKRSVTALLVLNLALADLAVLLTAPFF
LHNVAQRTWVFGLAACRLFHYVCGVSMYASVLLITTMSLDRSLAVALPFVSQKFRTKAVA
WWVLAGIWVMSLLLATPVVVYRTVTLAPNNWSLVCFLKYPSERLNAFHLLFEALTGFLLP
FLVVVASYSDIGRRLQARRFRRSRRTGRLVALIILTFAAFWLPYHVVNLAEAGRLLAGGE
AGPLQNRLLLARYVFIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEATGSEASST
RRGGTLAQTVRGAPATPENGTTESLTVSNPLQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcgctctgctgacgatcatcctcctgtcagtggcactggttgtggggcttccc
ggcaacagctttgtggtgtggagcatcctggtaaagatgcagaagcgctctgtcactgcc
ttgttggtgctgaacttggccctggccgacttggctgtattgcttactgccccctttttc
ctccacaacgtggcccaacgcacctgggtgttcggactggctgcctgccgcctgtttcac
tatgtctgcggagtcagcatgtacgccagcgtcctgctgatcacgaccatgagtctggac
cgctcgctggcggttgccctcccctttgtgtcccagaagtttcgtaccaaggccgttgcc
tggtgggtactggcaggcatctgggtgatgtcccttctgctggccacgcccgtcgtcgtg
taccgcacggtgaccttggcaccgaacaactggagcctggtgtgcttcctgaagtacccc
agcgaacgactcaacgccttccatctactcttcgaggccctcaccggcttcctgctgccc
ttcctggtggtggtggccagctactccgacatcggtcgcaggctgcaggcccggcgcttc
cgccgaagccgccgcacgggccgcctggtggcgctcatcatcctgaccttcgccgccttc
tggctgccctaccacgtggtgaacttggccgaggcgggccggttgctggccggcggggag
gcggggccgttgcagaaccggctgctcctggcgcgctacgtgttcatcgcgctggccttt
ctgagcagtagcgtgaaccccgtgctgtacgcgtgcgccggcggtggcctgctgcgctcg
gccggcgtgggcttcgtcgccaagctgttggaggccaccggctccgaggcgtccagcacc
cgccgcgggggcaccctggcccagacggtgaggggcgcccccgccactcccgagaatggc
accaccgagagcctcaccgtctccaaccctctccagtga

DBGET integrated database retrieval system