KEGG   Panthera pardus (leopard): 109256296
Entry
109256296         CDS       T06062                                 

Gene name
RNPEP
Definition
(RefSeq) aminopeptidase B
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109256296 (RNPEP)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     109256296 (RNPEP)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109256296 (RNPEP)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Other DBs
NCBI-GeneID: 109256296
NCBI-ProteinID: XP_019286996
Ensembl: ENSPPRG00000004693
Position
Unknown
AA seq 650 aa
MASDGPPSGCSAAPRPLHSAQAVDVASASNFRAFEMLHLHLDLRAEFGPPGPGPGSRNLS
GTAVLELRCLVPEGATELRLDSHPCLEVTAASLRRQRPDSKEQPAEPVHFRTQPFSHYGQ
ALCVALPQPFPAGERFQVLLTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFP
CFDTPAVKCRYSALIEVPDGFTAVMSANTWEKRGPNKFFFQMCQPIPSYLIALAIGDLVS
AEVGPRSRVWAEPCLIKAAKEEYNGVVEDFLATGEKLFGPYVWGRYDLLFMPPSFPFGGM
ENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRIST
VLFGSAYTCLEAATGRALLRQHMDITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCF
VSYLAHLVGDQDEFDNFLKAYVNEFKFQSILADDFLEFYLEYFPELKKKRVDSIPGFEFD
RWLNTPGWPPYLPDLSPGDSLMKPAEELAQLWVTRELDMKAIEAVAISTWKTYQLVYFLD
KILQKSPLPPGNVKKLGETYPKISNSRNAELRLRWGQIVIKNDHQEDFWKVKEFLQSQGK
QKYTLPLYHAMMGGSEVAQTLAKETFKATAPQLHSNVVNYVQQIVAPKGS
NT seq 1953 nt   +upstreamnt  +downstreamnt
atggcgagcgacgggcctccgagcggctgcagcgcggccccgcgaccgctgcactcggcg
caggccgtggacgtggcctcggcctccaatttccgggctttcgagatgctgcacttgcac
ctggacctgcgggccgagttcgggcctccggggccgggcccgggcagcaggaatttgagc
ggcaccgcggtcctggagctgcgctgcctggtgcccgagggcgccaccgagctgcggctc
gactcgcacccgtgcctcgaggtgacggcggcgtcgctgcggcggcagcggcccgactcg
aaggagcagcccgcggagcccgtgcacttccgcacgcagccgttctcgcactacggccag
gccctgtgcgtggcccttccgcagcccttcccggccggcgagcgcttccaggttctcctc
acctaccgcgtcggggagggacccggggtttgctggctggctcctgagcagacagcagga
aagaagaagccttttgtctatacccagggccaggctgtcctaaacagggccttcttccct
tgcttcgacactcctgcagtgaaatgcagatattcagctcttattgaggtcccagatggc
ttcacagctgtgatgagtgctaacacctgggagaagagaggtccaaataagttcttcttc
cagatgtgtcagcccatcccctcctatctgatagctttggccatcggagatctggtttcg
gcggaagttggacccaggagccgggtgtgggctgagccctgcctgatcaaggctgccaag
gaggagtacaacggggtggtagaagattttctggcaacaggagagaaactttttggaccc
tatgtttggggaaggtatgacctgctcttcatgcccccatcctttccatttggaggaatg
gagaacccttgtctgacctttgtcaccccctgcctgctagcaggggaccgctccttggct
gatgtcatcatccatgagatctcccacagttggtttgggaacctggtcaccaatgccaac
tggggtgaattctggctcaatgaaggtttcaccatgtatgcccagaggaggatctctact
gtcctctttggctctgcttacacctgcttagaagctgcaaccgggcgggctctgcttcga
cagcacatggacatcactggcgaggaaaacccactcaacaagctccgagtgaagattgaa
ccaggtgtggacccagatgatacctacaacgagaccccctatgagaaaggcttctgcttt
gtctcatacctggcccacttggtgggtgatcaggatgagtttgacaattttctcaaggcc
tatgttaatgaattcaaattccaaagtatcttagctgatgactttctagaattctacttg
gaatacttccctgagctgaagaagaagagagtggattccattccaggttttgagtttgat
cggtggttgaacacccctggctggcccccctacctccctgacctctcccctggggactcg
cttatgaagcctgctgaagagctggcccagctgtgggtgaccagggagctggacatgaag
gccattgaagctgtggccatttctacctggaagacctaccagctggtttacttcctagat
aagatcctccagaaatcccctctccctcccgggaatgtgaagaaactgggagagacttac
ccaaagatctccaactcccggaatgcggagctccggctccgatggggccagatcgtcatt
aagaatgaccaccaggaggatttctggaaagtgaaggaattcctgcagagccagggaaaa
cagaagtacactcttccgctgtaccacgcgatgatgggtggcagtgaggtggcccagacc
cttgccaaggagaccttcaaggccaccgccccccaactccacagcaacgttgtcaactac
gtccagcagatcgtggcgcccaagggcagttag

DBGET integrated database retrieval system