KEGG   Panthera pardus (leopard): 109257244Help
Entry
109257244         CDS       T06062                                 

Gene name
NIT1
Definition
(RefSeq) nitrilase homolog 1 isoform X1
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109257244 (NIT1)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     109257244 (NIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 109257244
NCBI-ProteinID: XP_019288759
Ensembl: ENSPPRG00000011271
Position
Unknown
AA seq 345 aa AA seqDB search
MVLAVSPCRTYRLPRRPRLGFIIRPPHQLLSLLLCPGLRIPRPSVLCAQPRPRAMAIFSS
SWELPLVAVCQVTSTPDKQQNFKTCAELVREAARLGACLAFLPEAFDFVARDPAETLRLS
EPLGGNLLGEYTQLARECGLWLSLGGFHERGQDWEQTQKIYNCHVLLDNKGSVVATYRKT
HLCDVEIPGQGPMRESNSTIPGPSLESPVSTPAGKVGLAICYDMRFPELSLALAQAGAEI
LTYPSAFGSVTGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVV
ARCSEGPGLCLARIDLRYLRQLRQQLPVFRHRRPDLYGSLGHPRS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggttttggctgtgtctccatgtaggacctaccgtctgccccgccggccgcggctgggc
ttcatcatcaggcctcctcaccagctcctgtcccttcttttgtgtcctggactccggatc
cctcgaccgtcagtactttgtgcacagcccaggcccagagccatggccatcttctcttct
tcctgggaactaccgctggtggctgtgtgccaggtaacctcaaccccagacaagcagcag
aactttaaaacatgcgcagagcttgttcgagaggctgccagactgggtgcttgcctggct
ttcctgccggaggcatttgacttcgttgcgagggaccctgcagagacgctccgcctgtct
gagccactgggtgggaaccttttaggagaatatacccagcttgccagggaatgtggactc
tggctgtccttgggtggtttccacgagcgaggccaggactgggaacagactcagaaaatc
tacaattgtcatgtgcttctggacaacaaggggtcagtagtggccacttacaggaagacc
catctgtgtgacgtggagattccagggcaggggcctatgcgtgagagcaactctaccatc
ccggggcccagtctcgagtctcctgtcagcacaccagcaggcaaggttggtctagcgatc
tgctacgatatgcgctttcctgaactctctctggcattggctcaggctggagcagaaata
cttacctacccttcagctttcggatctgttacgggcccagcccactgggaggtgttgctg
cgggcccgtgccattgaaacccagtgctacgtcgtggcagcagcacagtgtggacgccac
cacgagaagagagcaagttatggccacagcatggtggtggatccctgggggacagtggtg
gcccgctgctctgaaggaccgggcctctgccttgcccgaatcgacctccgttatctgcga
cagctgcgccaacagctgcctgtgttccggcaccgcaggccggacctctacggcagtctg
ggccacccacggtcttaa

DBGET integrated database retrieval system