KEGG   Panthera pardus (leopard): 109258641Help
Entry
109258641         CDS       T06062                                 

Gene name
SEPT5
Definition
(RefSeq) septin-5 isoform X1
  KO
K04557  septin 5
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109258641 (SEPT5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppad04131]
    109258641 (SEPT5)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ppad04812]
    109258641 (SEPT5)
Membrane trafficking [BR:ppad04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    109258641 (SEPT5)
Cytoskeleton proteins [BR:ppad04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     109258641 (SEPT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin RsgA_GTPase MMR_HSR1 GTP_EFTU Roc Ras AAA_16 AAA_22 AAA_29 NACHT ABC_tran
Motif
Other DBs
NCBI-GeneID: 109258641
NCBI-ProteinID: XP_019291165
Ensembl: ENSPPRG00000002930
Position
Unknown
AA seq 378 aa AA seqDB search
MDSLAAPQDRLVEQLLSPRTQAQRRLKDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAG
ESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPG
FGDAVNNSECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVD
VGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDF
KQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTH
MHDLKDVTCDVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEE
LRRMQEMLQKMKQQMQDQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggactcgctggcagcgccccaggaccgcctggtggagcagctgctgtcaccgcggacc
caggcccagaggcggctcaaggatatcgacaagcagtacgtgggcttcgccacactgccc
aatcaggtgcaccggaagtctgtgaagaagggcttcgatttcacgcttatggtggcgggt
gagtcgggcctggggaagtccacgctggtccacagcctcttcctgaccgacttgtacaag
gaccggaagctgctcagtgctgaggagcgcatcagccagaccgtagagatcctgaagcac
acggtggacattgaggagaagggggtcaagctgaagctcaccattgtagacacaccgggc
ttcggggatgctgtcaacaactctgagtgctggaagcccatcaccgactacgtggaccag
cagtttgagcagtattttcgtgacgagagtggcctcaaccgcaagaacatccaagacaac
cgtgtgcactgctgcctctacttcatctccccttttggacacgggctgcggccagtggat
gtgggtttcatgaaggctctgcatgagaaggtgaacattgtgccgctcatcgccaaagct
gactgtctcgtccccagcgagatccggaagctgaaggagcggatccgggaggagattgac
aagtttgggatccacgtgtaccagttccctgaatgtgactctgacgaggatgaggacttc
aagcagcaggatcgggaactgaaggagagtgcgcccttcgcggttatcggcagcaacaca
gtggtggaggccaaggggcaacgggtccgggggcgactgtacccctgggggatcgtggag
gtggagaaccaggcacactgcgactttgtgaagcttcgcaatatgctgatccgcacacac
atgcatgatctcaaggacgtgacatgcgacgtgcactatgagaactatcgcgcgcactgc
atccagcagatgaccagcaaactgacccaggacagccgcatggagagccccatccccatc
ctaccactgcctaccccggatgctgagacagaaaagctcatcaggatgaaggatgaggag
ctaaggcgcatgcaggagatgctgcagaagatgaagcagcagatgcaggaccagtga

DBGET integrated database retrieval system