KEGG   Panthera pardus (leopard): 109260203
Entry
109260203         CDS       T06062                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ppad03000]
    109260203 (AHRR)
Transcription factors [BR:ppad03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109260203 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 109260203
NCBI-ProteinID: XP_019293798
Ensembl: ENSPPRG00000002696
Position
Unknown
AA seq 713 aa
MMIPPGECMYAGRKRRKPIQKQRPATGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIVS
KLDKLSVLRLSVSYLRVKSFFEAVQKCPRQPAAGTPSPEDSGLSGGSTVLEGRLLLESLD
GFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQA
VFGQPLHSDTEDAVLGRLLRAQEADFSAFLTRCFVCRVRCLLDSTSGFLTMQFQGKLKFL
FGQKRKTPSGTVLPPRLSLFCIVVPVLLPSVAEMKMKSAFLRVKHRVDVSGSVDTKAKAA
SSLCEPASHGKPHCLAGRSIGENISVLKAQADAGCWARVPARAPCPCLRSSPDLVSDPEG
AAGDRGGEEHGGVPGSTPGARGRRERPAYSCCFEAPGPVRHLNWMTGKHGPDGGTNVKLG
PSKSDPFSTHTVSRGSCVSCPGVQGTVHSSGVTAFRNSPGCHPGSHSPSAYASRTSRALQ
DGCKGPPLPSCPFPQGSLDNGLPPPRGQRLAAGGYSTEDTKFRGGPVPAGAPCNPMLSLD
VPVKLENDSGSEDAADGYLVSPGQVWLGASGVAKRQLVTFPTRIHLKTESDSRPHLYAPH
LGHSMLGAHLSGRAPLRPGKEPAPLRPAHCACLQHVHGLPEPDPPRHLCAHGHQPPTLSC
DCRAPGTTPVVKREPLDSPPWASHSQGGVPGMFPRSALPTLMPPKAPECAFLP
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgatgattccaccaggggagtgcatgtatgctggaaggaaaagaaggaagcccattcag
aaacagaggccggccacgggggctgagaagtcaaacccgtccaagcggcaccgggaccgc
ctcaacgccgagctggaccacctggccagcctgcttccgcttcctcctgacatcgtgtct
aagctggacaagctttctgtcctgcgtctcagcgtcagctacctcagggtgaagagcttc
tttgaagccgtgcagaagtgcccacggcagccggcggctggtaccccctcaccagaagac
agcggtctgagcggagggtccaccgtgctggagggaaggctcctgctggagtctctcgat
ggctttgccctggtcgtgagtgcggaaggcatgatattttatgcgtcagcaacgatcgtg
gactatctgggcttccaccagacggacgtgatgcaccagaacatctatgactatatccac
gtggatgaccgccaggacttctgccggcagctgcactgggccatggaccctccccaggcg
gtgtttgggcagcccctgcactcagacacagaggacgcggtgctggggcggctgctccgg
gcgcaggaggcggacttctcggccttcctgacgcgctgcttcgtgtgccgcgtgcgctgc
ctgctggacagcacctcgggcttcctgacaatgcagtttcaaggaaaactaaaattcctg
tttggacagaagaggaagactccatcagggacagtcctgccccctcggctgtcactgttc
tgcatcgtggtgcccgtcctccttccttccgtggcggagatgaaaatgaagagtgcgttt
ctgagagtgaagcacagggtggacgtctcaggctcagtggacacaaaagcaaaagccgcc
tcgagtctgtgtgagccagcatcgcatggaaaaccccactgcctagcagggaggagcatt
ggagaaaacatttcagtgctcaaggcacaagcggatgcaggctgctgggcccgggttcca
gccagagccccatgtccctgcctcaggagcagcccagacctcgtttctgaccccgagggg
gccgcaggggacaggggaggagaggagcacgggggggtgcctggcagcactcccggagcc
agggggcggagggaaagacctgcgtatagttgctgctttgaggcgcctggacccgtgagg
cacctgaactggatgacagggaaacatggtccagatggtggcaccaacgtgaagctggga
cccagtaagagtgacccgttctccacacacaccgtgtcccgtggctcctgcgtgtcctgc
cccggtgttcagggcactgtccatagcagtggggttactgctttccggaattcacccggc
tgtcacccaggaagccactctcccagtgcctatgccagccgcacgagcagagccttgcag
gacggctgcaaggggccccctctacccagctgccccttcccccaggggagcctggacaat
gggctccctccgcccagagggcagcgtctcgcagcggggggctattccactgaggacacc
aagtttcgaggggggccggtgcccgcgggagccccatgcaaccccatgttgtcacttgat
gtgcccgtcaagctggagaacgactctgggtctgaggacgcagcagacggctacctcgtg
tccccaggccaggtgtggctgggagccagtggtgtggccaagagacagctggtcactttc
cctaccaggatacacctgaagacagagtcagactccagaccccacctctatgctccacac
ctggggcacagcatgctgggggctcacctgagcggcagggctccactcagacccggcaag
gagccggcgcccttacgccccgcacactgtgcctgcctgcagcatgtgcatggccttccc
gagccagatcctccccgccacctctgtgcacacggtcaccagccccctacactgagctgt
gactgcagagctcccggcaccacacccgttgtcaagcgcgagcccctggactcacccccg
tgggcaagccacagccagggtggggtgcccggcatgttccccagaagtgccttgccaaca
ctgatgccccccaaagcccccgagtgtgctttcctgccgtag

DBGET integrated database retrieval system