KEGG   Panthera pardus (leopard): 109261868Help
Entry
109261868         CDS       T06062                                 

Definition
(RefSeq) heat shock 70 kDa protein 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad03040  Spliceosome
ppad04010  MAPK signaling pathway
ppad04141  Protein processing in endoplasmic reticulum
ppad04144  Endocytosis
ppad04213  Longevity regulating pathway - multiple species
ppad04612  Antigen processing and presentation
ppad04915  Estrogen signaling pathway
ppad05134  Legionellosis
ppad05145  Toxoplasmosis
ppad05162  Measles
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109261868
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109261868
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109261868
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109261868
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    109261868
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109261868
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109261868
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    109261868
  09172 Infectious disease: viral
   05162 Measles
    109261868
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109261868
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppad01009]
    109261868
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ppad03041]
    109261868
   03009 Ribosome biogenesis [BR:ppad03009]
    109261868
   03110 Chaperones and folding catalysts [BR:ppad03110]
    109261868
   04131 Membrane trafficking [BR:ppad04131]
    109261868
   03051 Proteasome [BR:ppad03051]
    109261868
   03029 Mitochondrial biogenesis [BR:ppad03029]
    109261868
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppad04147]
    109261868
Protein phosphatases and associated proteins [BR:ppad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     109261868
Spliceosome [BR:ppad03041]
 Complex B
  Other components
   Prp19 complex
    109261868
 Complex C
   Prp19-CDC5 complex
    109261868
Ribosome biogenesis [BR:ppad03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    109261868
Chaperones and folding catalysts [BR:ppad03110]
 Heat shock proteins
  HSP70 / DNAK
   109261868
Membrane trafficking [BR:ppad04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    109261868
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    109261868
Proteasome [BR:ppad03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    109261868
Mitochondrial biogenesis [BR:ppad03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    109261868
Exosome [BR:ppad04147]
 Exosomal proteins
  Proteins found in most exosomes
   109261868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR Pox_D5 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 109261868
NCBI-ProteinID: XP_019295846
Position
Unknown
AA seq 274 aa AA seqDB search
MAKTAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFRVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTL
NT seq 821 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaccgcagccatcggcatcgacctgggcaccacctactcatgcgtgggggtg
ttccagcacggcaaggtagagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgttcgacgcgaagcggctgatcggccgcaagttcggcgac
ccggtggtgcagtcggatatgaagcactggcctttccgggtgatcaacgacggagataag
cccaaggtgcaggtgagctacaagggggagaccaaggcgttctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcggcaggccaccaaggac
gcgggggtgatcgcggggctgaacgtgctgcggatcatcaacgagcccacggccgccgcc
atcgcctacggcctggacaggacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggcgggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagaggaagcacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagcgggccaagaggaccct

DBGET integrated database retrieval system