KEGG   Panthera pardus (leopard): 109262539
Entry
109262539         CDS       T06062                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ppad03036]
    109262539 (ANKRD53)
Chromosome and associated proteins [BR:ppad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109262539 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 109262539
NCBI-ProteinID: XP_019296846
Position
Unknown
AA seq 491 aa
MPPAKKFSHKVSWGGSSPKQPRASGPDRDSAFSLTSSLPTLHLRYNSNPDEWDKRAIGSY
YELYAAALGNLEWLRFCLSWHREEIPADDKGFTAIHFAAQSGKLACLKVLVEEYKFPVDL
PTNNGQTPLHLAIHKDNKTMILPCIHYLLKQGAALNTQTCNGSTPLHLAACQGLLKCVKV
LVQNGADVHARDATGCKPIDYCKIWNHRDCARFLKDAMWKRDKKDFACEMGKLKTLKDQL
ALMEQDYLTEYQKEHQILREANFKKWLHCKQLLRGQSLIQTAKREPCTPHQAMALSKATK
YQGLRPPKSFYPSPEARLRETLRPKLQPLRTHTPIYMQPMVRRPKSWNVSNNPARSPTTQ
IGYTQGIRLGVHPDPSSEHDFRSFLKVRSDRHGSAKLCTVAGNQVTPVPQLPFQVMVQEL
YPSVRPYRMKVPQGFCSVSMKDVPQKRHLGDNNFWIDTLAMNLRETFDEAFLAAVQAHQR
LPTRPYLKSPP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgccgccagcgaagaagttctcccacaaggtctcctggggtggttcgtcgcccaagcag
cccagggcctccggcccagaccgggactccgctttctcactcacctcctcgcttccaacc
ctccacttgcgctacaactctaacccggatgagtgggacaagagggccatagggagctac
tacgagttgtacgcggcggcgctgggcaacctggaatggttgcggttctgtctgagttgg
caccgtgaggaaatcccggcagatgacaagggtttcactgccatccacttcgcagcccag
agtggcaagcttgcatgcctgaaggtcttggtagaggagtacaagtttcccgtggacctg
cccaccaacaatggccagacacccctgcacctggccatccacaaggacaacaagaccatg
atcctcccctgcattcactacctgcttaagcaaggggcggccctcaacactcagacatgc
aatggctccacacccctccacctggcggcctgccagggcctgctgaaatgtgtgaaggtc
ctggtgcaaaatggggccgatgtccatgcccgagatgccacgggctgcaaacccatcgac
tactgcaaaatatggaatcaccgcgactgtgccaggttcttgaaggatgccatgtggaaa
cgggacaagaaggactttgcttgtgagatggggaaattgaagacgctcaaggaccagctg
gccctcatggaacaggactacctgactgagtatcaaaaagagcaccaaattctgagagaa
gctaatttcaagaagtggctccactgcaagcagctgctccgaggccaatccctgatccag
accgccaagcgagagccttgtaccccacaccaggctatggccctctccaaggccaccaag
taccagggactgaggcctcccaagagcttctacccctccccagaggcgcgcctgcgagag
acactgcggcccaagctgcagcccttgaggacacacacgcccatctacatgcagcccatg
gtcaggcggcccaagtcatggaatgttagcaacaatcctgccagatcacccaccacccag
atcggctacacgcagggcatccgcctgggtgtgcatccagaccccagctcagagcatgac
ttccgcagcttcctcaaggtgaggtccgacaggcacggtagtgccaaactgtgcacagtg
gccggcaaccaggtgacacctgtgccccagctgcctttccaggtgatggtccaagagctg
tacccttcggtgcggccatacaggatgaaagtgccccagggcttttgctctgtcagcatg
aaggatgtgccccagaagcggcacttgggtgataacaacttctggattgacactctggcc
atgaacctgcgtgagacatttgatgaagccttcctggcagctgtgcaagcccatcaaagg
ctccccactcgaccctacctgaaaagtcccccataa

DBGET integrated database retrieval system