KEGG   Panthera pardus (leopard): 109263482Help
Entry
109263482         CDS       T06062                                 

Gene name
ATG5
Definition
(RefSeq) autophagy protein 5 isoform X1
  KO
K08339  autophagy-related protein 5
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04136  Autophagy - other
ppad04137  Mitophagy - animal
ppad04140  Autophagy - animal
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad04216  Ferroptosis
ppad04621  NOD-like receptor signaling pathway
ppad04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109263482 (ATG5)
   04136 Autophagy - other
    109263482 (ATG5)
   04137 Mitophagy - animal
    109263482 (ATG5)
  09143 Cell growth and death
   04216 Ferroptosis
    109263482 (ATG5)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109263482 (ATG5)
   04622 RIG-I-like receptor signaling pathway
    109263482 (ATG5)
  09149 Aging
   04211 Longevity regulating pathway
    109263482 (ATG5)
   04213 Longevity regulating pathway - multiple species
    109263482 (ATG5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppad04131]
    109263482 (ATG5)
   03029 Mitochondrial biogenesis [BR:ppad03029]
    109263482 (ATG5)
Membrane trafficking [BR:ppad04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    109263482 (ATG5)
Mitochondrial biogenesis [BR:ppad03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    109263482 (ATG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APG5
Motif
Other DBs
NCBI-GeneID: 109263482
NCBI-ProteinID: XP_019298539
Ensembl: ENSPPRG00000012874
Position
Unknown
AA seq 275 aa AA seqDB search
MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYLLLPRVSYLTLVTDKVKKHFQKVM
RQEDISEIWFEYEGTPLKWHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDA
IEAHFMSCVKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEEN
GFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKDVCPSAVAPEDGEKKNQVMI
HGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgacaaagatgtgcttcgagatgtatggtttgggcgaattccaacttgcttc
accctgtatcaggatgagataactgaacgggaggcagaaccatattatttgcttttgcca
agagtaagttatttgacgttggtaactgacaaagtgaaaaagcactttcagaaggttatg
agacaagaagacattagtgagatatggtttgaatatgaaggcacaccactgaaatggcat
tatccaattggtttgttatttgatcttcttgcatcaagttcagctcttccttggaacatc
acagtgcattttaagagttttccagaaaaggaccttctgcactgtccatctaaggatgca
attgaagctcattttatgtcttgtgtgaaagaagctgatgcattaaagcataaaagtcaa
gtaatcaatgaaatgcagaaaaaagatcataagcagctctggatgggattacaaaatgac
agatttgatcaattttgggccatcaaccggaaactcatggaatatcctgcagaagaaaat
ggatttcgttatatcccttttagaatatatcagacaacgactgaacgacctttcattcag
aagctttttcgtcctgtggctgcagatggacaattgcacacactaggtgatctcctcaaa
gacgtttgtccttctgcagtggctcctgaagatggggaaaaaaagaatcaagtgatgatt
catggaattgagccaatgttggaaacacctctgcagtggctgagtgaacacctgagctac
ccagataattttcttcatattagtatcatcccgcaaccaactgattga

DBGET integrated database retrieval system