KEGG   Panthera pardus (leopard): 109264806
Entry
109264806         CDS       T06062                                 

Gene name
RNPEPL1
Definition
(RefSeq) arginyl aminopeptidase-like 1
  KO
K09605  arginyl aminopeptidase-like 1 [EC:3.4.11.-]
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109264806 (RNPEPL1)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109264806 (RNPEPL1)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109264806 (RNPEPL1)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N DUF2268
Other DBs
NCBI-GeneID: 109264806
NCBI-ProteinID: XP_019300877
Position
Unknown
AA seq 620 aa
MQIPGSWPQKALGWGLGVCSVEQAPQTGLVHVEGRQKKKMPPQASHSEGTETERPEGSFK
DTCEHWPASGRGRIWWLDPELTYGNAKPFVFTQGHSVCNRSFFPCFDTPAVKCTYSAVVK
APSGVQVLMSATQSTYVEEEGVYRFHMEHPVPAYLVALVAGDLQPADIGPRSRVWAEPCL
LPTATSKLSGAVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTFIISSILES
DEFLVIDVIHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAAFTCLETAFR
LDALHRQMKLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGDPQRFD
DFLRAYVEKYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDL
SQGSSLTRPVEALFQLWTAEPLDQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVV
TRLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCT
GALKSFALEVFYQTQGRLHPNLRRTIQQILSQGLGPGAEPSAEQGGAGADSEVDPEAPAL
LLGDEAPGAAISLRDVNVSA
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgcagattcctgggtcctggccccagaaagctctggggtggggcctgggagtctgcagc
gttgaacaggctccacaaacaggccttgtgcacgtcgagggtcggcagaaaaagaagatg
ccaccacaggcttcccatagtgaggggacagagacagagcggccagagggaagttttaaa
gacacctgtgaacactggccagcgtctggccggggccggatctggtggctggaccccgag
ctgacctatggcaacgccaagcccttcgtcttcacccagggccactcggtgtgcaaccgc
tccttcttcccctgcttcgacacgcccgccgtcaagtgcacctactcggccgtcgtcaag
gccccgtcgggggtgcaggtgctgatgagtgccacgcagagcacgtacgtggaggaggag
ggcgtctaccgctttcacatggagcaccctgtgcccgcctacctcgtggccctggtggcc
ggggacctccagccggcagacatcgggcctaggagccgcgtgtgggctgagccgtgcctc
ctgcccacggctaccagcaagctgtcgggcgcagtggagcagtggctgagcgcagccgag
cggctgtatgggccgtacatgtggggcaggtacgacattgtcttcctgccgccctccttc
cccatcgtggccatggagaacccctgcctcaccttcatcatctcctccatcctggagagt
gacgagttcctggtcatcgacgtcatccacgaggtggcccacagctggttcggcaacgcc
gtcaccaacgccacgtgggaggagatgtggttgagtgagggcctggccacctacgcccag
cgccgcatcaccactgagacctacggggctgccttcacctgtctggagacggccttccgc
ctggatgccctgcacaggcagatgaagctcctcggagaggacagcccggtcagcaagctg
caggtcaagctggagccaggagtgaatcccagccacctgatgaacctgtttacgtacgag
aagggctactgcttcgtgtactacctgtcccagctgtgtggagacccccagcgctttgac
gactttctccgagcctacgtggagaagtacaagttcaccagcgtggtagcccaggacctg
ctggactccttcctgagcttcttcccagagctgaaggagcaaagtgtggactgccgggca
gggctggagttcgagcgctggctcaacgccacgggccccccactggccgagccggacctg
tcccagggctccagcctcacccggcccgtggaggccctcttccagctctggaccgcggag
cctctggatcaggcggccgcctctgccagtgccatcgacatctccaagtggaggaccttc
cagacagcgctcttcctggaccggctcctggacgggtccccgctgccccaggaggtggtg
acgcgcctgtccaagtgctactcgtccctgctggactccatgaacgccgagatccgtatc
cgctggctgcagatcgtcgtccgcaacgactactaccccgacctccaccgggtccggcgg
ttcctcgagagccagatgtcccgcatgtacaccatcccgctgtacgaggacctctgcacc
ggcgccctcaagtccttcgccctggaggtgttctaccagacccagggccggcttcacccc
aacctgcgcaggaccatccagcagatcctgtcccagggcctgggccctggcgccgagccc
agcgcggaacaaggcggtgccggagcagactcggaggtggacccagaagcaccggccctg
ctgctcggggacgaggcccccggcgccgccatttctctcagggacgtcaacgtgtctgcc
tag

DBGET integrated database retrieval system