KEGG   Panthera pardus (leopard): 109265368
Entry
109265368         CDS       T06062                                 

Gene name
LTA4H
Definition
(RefSeq) leukotriene A-4 hydrolase isoform X1
  KO
K01254  leukotriene-A4 hydrolase [EC:3.3.2.6]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00590  Arachidonic acid metabolism
ppad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109265368 (LTA4H)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109265368 (LTA4H)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.6  leukotriene-A4 hydrolase
     109265368 (LTA4H)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109265368 (LTA4H)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 109265368
NCBI-ProteinID: XP_019302038
Ensembl: ENSPPRG00000001567
Position
Unknown
AA seq 611 aa
MPEVVDTCSLASPASVCRTKHLHLRCSVDFTRRVLTGTAALTVQSQEDNLRSLILDTKDL
TIEKVVINGQDVKYALGERQSYRGSPMEISLPIALSKNQEVVIEISFETSPKSSALQWLT
PEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKSTYSAEVSVPKELVALMSAIRDGEAP
DPEDPSRKIYRFSQKVPIPCYLIALVVGALESRKIGPRTLVWSEKEQVEKSAYEFSETES
MLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISH
SWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFHALGGWGELQNSIKTFGDT
HPYTKLVVDLTNVDPDVAYSSVPYEKGFALLFYLEQLLGGPEVFLGFLKAYVEKFSYKSI
TTDDWKDFLYSHFKDKVDILNQVDWNAWLYSPGMPPVKPNYDMTLTNACIALSQRWMAAK
EDDLNSFTAADLKDLSSHQLNEFLAQMLQKAPLPLGHIKRMQEVYKLNAVNNSEIRFRWL
RLCIQSKWEEAVPLALKMATEQGRMKFTRPLFKDLAAFDKYHDQAVRTYQEHRASMHPVT
AMLVGKDLKVD
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcccgaggtagtggatacgtgctccttggcctctccggcttcggtctgccggaccaag
cacctgcacctacgctgcagcgtcgactttacccgccgggtgttgaccggcaccgccgcg
ctcacggtgcagtctcaggaggacaatctgcgcagcctgattttggatacaaaggacctc
acgatagaaaaagtggtcatcaatggacaagacgttaaatatgctcttggagaaagacaa
agttacagaggatcaccaatggaaatctctcttcctattgctctgagcaaaaatcaagaa
gtcgttatagaaatttcttttgagacatctccaaagtcttctgctcttcagtggctcact
cctgaacaaacttctgggaaggaacacccatatctctttagtcagtgccaggccatccac
tgcagagcaattcttccttgccaggacactccttctgtgaaatcaacctatagtgctgag
gtgtctgttcctaaagaattggtggcacttatgagtgccattcgtgatggagaagcacct
gacccagaagacccgagcaggaaaatctatagattcagccaaaaagttccgatcccctgc
tacctgatcgctttagttgttggagctttagaaagcaggaagattggcccaagaacactg
gtttggtctgagaaagagcaggtggaaaagtctgcttatgaattttctgagactgaatct
atgcttaaaattgcagaagatctgggaggaccgtatgtttgggggcagtatgacctgtta
gtcctgccaccatccttcccttacggtggcatggaaaatccttgcctcacttttgtaact
cctactctgctggcaggagacaagtcactctccaatgttattgcacatgaaatatctcat
agttggacaggaaatctagtgaccaacaaaacttgggaccacttttggttaaacgaagga
catactgtgtacttggaacgccacatttgtggacgactgtttggtgaaaagttcagacat
tttcatgctctgggaggatggggagaactacagaattcaataaagacgtttggagataca
catccttacaccaaacttgtggttgatctgacgaatgtggaccctgatgtagcatattct
tcagttccctatgagaagggctttgctttactcttttaccttgaacaacttcttgggggc
ccagaggttttcctaggatttctaaaagcttatgttgagaagttttcctataagagcata
accactgatgactggaaggatttcctgtattcccactttaaagataaggttgatattctc
aatcaagttgattggaatgcctggctgtactctcctggaatgcctcctgtaaaacccaac
tatgatatgactctgacaaatgcttgcattgccttaagtcagcggtggatggcggccaaa
gaagatgatttaaactcattcaccgcagcagacctgaaggacctctctagtcatcagctg
aacgaattcttagcacagatgctccagaaagcacctcttccattggggcatataaagcga
atgcaagaggtgtacaagttgaatgccgttaacaattctgaaatacgattcagatggtta
cggctctgcattcaatcgaaatgggaggaagcagttcctttggctctaaaaatggcaact
gagcaaggacgaatgaaatttacgcggcccttattcaaagaccttgctgcctttgacaaa
taccacgatcaagccgtccgtacctaccaggagcacagagctagcatgcaccccgtgacg
gccatgctggtggggaaagatttaaaagtggattga

DBGET integrated database retrieval system