KEGG   Panthera pardus (leopard): 109265812Help
Entry
109265812         CDS       T06062                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
Organism
ppad  Panthera pardus (leopard)
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA DIRP
Motif
Other DBs
NCBI-GeneID: 109265812
NCBI-ProteinID: XP_019302913
Position
Unknown
AA seq 266 aa AA seqDB search
MHLGGGLQGSKGCILSPSSHGKRVKHAIDILWHLVNTFVPVYPERLWIEQKTFCNAFPFH
IVFDESLRVKQAGVNIQKYVPGLQNQKIRLDDYFSIIHPQVTFDIFSICKFINSQFVLKV
RRERMPEAWKSQPALKLRGQMIWMESARCVIYLCSPKLRSLRELEAHRMHLSDIAPHDTT
RDLILLNQQRLAEIELSNQLERKKEELRVLSQHLAIEKKKTETLLYAMLPEHVANQLKEG
KKVAAGKAFPPLHGCPWARVAVCLRG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgggaggaggtctgcagggctcaaaaggctgcattttgagtccctcaagccat
ggcaagcgagtcaaacacgcaattgacatcctttggcatctcgtgaacacctttgtgccc
gtttatcccgagcgtctctggattgaacagaagacattctgcaatgcttttcctttccac
attgtatttgatgaatcactgagggtcaagcaagctggagtgaatattcagaagtatgtc
ccaggactccaaaaccagaagattcgattggatgactatttctccatcattcatccccaa
gttaccttcgacattttcagcatctgcaaatttatcaacagtcaatttgtcctgaaggtc
cgaagagaaagaatgcctgaggcatggaaaagtcagcccgcactcaaactgcgaggccag
atgatctggatggagtccgcgcggtgcgtgatatacctgtgctccccgaagctccgcagc
ctgcgagagctggaggcgcaccggatgcacctgtctgacatcgccccccacgacaccacc
agggacctcatcctcctgaaccagcagcggctggcagagattgagctgtccaaccagctg
gagaggaagaaggaggagctgcgggtcctctcccagcacttggccatagaaaagaagaaa
accgagaccttgctttatgccatgctgccggaacatgtggccaaccagctgaaggagggc
aaaaaggtcgccgcgggtaaagcattccctccccttcatgggtgcccctgggcaagagta
gcggtgtgcctcaggggttag

DBGET integrated database retrieval system