KEGG   Panthera pardus (leopard): 109268337
Entry
109268337         CDS       T06062                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ppad01009]
    109268337 (AKAP5)
Protein phosphatases and associated proteins [BR:ppad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     109268337 (AKAP5)
SSDB
Motif
Pfam: WSK Amidohydro_3 NINJA_B
Other DBs
NCBI-GeneID: 109268337
NCBI-ProteinID: XP_019307124
Ensembl: ENSPPRG00000020623
Position
Unknown
AA seq 429 aa
MEATVSEIQVESKDEKRPTEVSPQDERQEEKASVLCFKRRKKAAKEMKPKASSKAAGAAR
TGLPEAGASDQPQAPVGAWASIKRLVTHRKRSEASKQQKPFEAKVQPEISAEDADLSRKK
AKSRLKIPCIKFSKGEKRSNHSKIIEDSDCSLRVQGEAERLDTEAPTQSDDQATTPKLPQ
DVSKAVSQKGGDEVCEPNVSHSTTAPGEKVIAVELGLDTGHSAIHTGTLVIERDTETTEE
KQRVQPQQASPLEPSETQQQLPVASDVPPSPAVPDQQIVEEAKSNILESGPNWKQHESGE
MVAEESEPKDTELSQESELRGNEVTAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNV
PKQFLISIENEQIGVFANDSGFEGRTSEQYETLLKETASSLVKNAIQLSIEQLINEMASD
DNKINNLLQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggaagccacagtttctgaaattcaagtcgaaagcaaggatgagaagagacccacagaa
gttagtcctcaagatgagcggcaggaggaaaaagcatcagtgctttgcttcaagagaaga
aagaaagcagccaaagagatgaagcccaaagctagctctaaagctgctggtgcagcaaga
acgggtctcccagaggcgggagcttctgatcagccccaggccccagtgggggcctgggcg
tcaatcaaacgtcttgtaacgcacaggaaaaggtcagaagcttcaaagcagcaaaagccc
tttgaggctaaagtccaacctgaaatcagtgctgaggatgctgatctttctaggaaaaag
gcaaaatccagactcaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cattccaaaattatagaagactccgactgcagcctcagagtccagggagaggctgaacgt
ttggatacggaagctccaacccaatccgatgaccaggcaaccacgcccaagttgccccag
gatgtgagtaaagctgtctcacagaaagggggcgatgaggtctgtgagccaaacgtgagc
cacagcacaacggcacctggggaaaaagtgattgcagtagaacttgggttagacactggg
cattctgccattcacacaggaacgctagtcattgaacgagatactgaaacaactgaggaa
aaacaacgcgttcaaccccagcaagcaagcccacttgaaccttcagaaacacaacagcaa
ctgccggtggcttctgatgtccctccctcacctgcagtcccagatcagcaaattgtggaa
gaagccaaaagcaatatcctagaaagtggaccaaattggaaacagcacgaaagtggagag
atggttgctgaagagagtgagccaaaagatactgaactgagccaggaatcagagcttaga
ggaaatgaggtcactgcagagaaaccaaaaccagaagaaagcaaaagaatggagccaatc
gctattattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtc
cctaagcaattcttaatttcaattgaaaatgagcaaataggggtttttgctaatgatagt
ggttttgagggtagaacttcagaacaatacgaaacactcttaaaagaaacggcttcttct
cttgtcaagaatgctattcagttgtctatagaacagctgattaatgaaatggcctctgat
gataataaaataaacaatcttctgcagtga

DBGET integrated database retrieval system