KEGG   Panthera pardus (leopard): 109270294
Entry
109270294         CDS       T06062                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    109270294 (RDH5)
Enzymes [BR:ppad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     109270294 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 109270294
NCBI-ProteinID: XP_019310238
Ensembl: ENSPPRG00000024846
UniProt: A0A6P4WSU4
Position
Unknown
AA seq 318 aa
MWLPLLLGVLIWAALWLFRDRQSLPASDAFIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTEPQSVQRAAKWVETHVGEAGLFGLVNNAGVAGIIGP
TPWLTRDDFHRVLSVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFQTPVTNLESLENTLQECWARLPPDTQAHYGEA
FLTKYFKMQRRIMSLICDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDALLTWVFPKPAQAVC
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggagtcttgatctgggcagcgctgtggttgttcagggac
cgacagagcctgcccgccagcgatgctttcatcttcatcaccggctgtgactcaggcttc
gggcggcttctggcactgagactggaccagagaggcttccgagtcctggccagctgcctg
accccctcaggggcagaggacctacagcgcgtggcctcctctcgcctccacaccaccctg
cttgatgtcactgagccccagagtgtccagcgggcagccaagtgggtggaaacacatgtt
ggtgaagcagggctttttggtctggtgaataatgctggtgtggctggtatcattgggccc
acgccgtggctcacacgagatgatttccatcgggtgctgagcgtgaatacgctgggtccc
atcggggtcacccttgccctgctccccctgctccagcaggccaggggccgggtggtcaac
atcaccagtgttctgggtcgcctggcagccaatggtgggggctactgtgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgggatgtggctccttttggtgtccgagtc
tccattgtggagcctggcttcttccaaacccctgtgacaaacctggagagtttggagaac
acgctgcaggagtgctgggcacggctacctcctgacacacaggcccactacggggaggcc
ttcctcaccaagtactttaaaatgcagcggcgcatcatgagcctgatctgtgacccagac
ctgaccaaggtgagcaggtgcctggagcatgccctgactgctcgtcaccccagaacccgc
tacagcccaggctgggatgccaagctgctctggctgccggcctcctacttgccagccagc
ctggtggatgctttgctcacctgggtctttcccaagcctgcccaggcagtctgctga

DBGET integrated database retrieval system