KEGG   Panthera pardus (leopard): 109270521
Entry
109270521         CDS       T06062                                 

Gene name
TRHDE
Definition
(RefSeq) thyrotropin-releasing hormone-degrading ectoenzyme
  KO
K01306  pyroglutamyl-peptidase II [EC:3.4.19.6]
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109270521 (TRHDE)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.6  pyroglutamyl-peptidase II
     109270521 (TRHDE)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109270521 (TRHDE)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Rtf2
Other DBs
NCBI-GeneID: 109270521
NCBI-ProteinID: XP_019310661
Ensembl: ENSPPRG00000007335
Position
Unknown
AA seq 1069 aa
MALDGERGEQEEEKKKKKKKKKRKKKKEEEEEEEGAEKSSSPFAATMGENDAALRAGGRG
LSDPWTDSVGVRPRTTERHITVHKRLVLAFAVSIVALLAVTMLAVLLSLRFDECGASAAP
GADGGPAGFPARGGNASLPGSARRNHHAGGDSSQPEVGGEATPGTPSAQPPSEEEREQWQ
PWTQLRLSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQV
AEDRVAGAVPVAGFFLYPQTQVLVVVLNRTLDAQRNYNLKIIYNALIENELLGFFRSSYV
LHGERRFLGVTQFSPTHARKAFPCFDEPIYKATFKISIKHQATYLSLSNMPVETSVFEED
GWVTDHFSQTPLMSTYYLAWAICNFTYKETTTKSGVAVRLYARPDAIRRGSGDYALHITK
RLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRILLDPSVSSISYLLDV
TMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLTDVLH
EVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYL
TIHKYGNAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENRIII
TQQHFIYDIRAKTKALELQNTSYLWQIPLTIVVGNRSHVSSEAIIWVSNKTEHHRITLDK
GSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGSLPQ
HIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMEKYNVFNEYILKQVAATYIKLGWP
KNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDI
VYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLNSEVVL
DQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTESEL
KELKNFMKNYDGVAAASFLRAVETVEANVRWKMLYQDELFQWLGKALRH
NT seq 3210 nt   +upstreamnt  +downstreamnt
atggccctggacggcgagcggggggagcaagaggaggagaagaaaaagaagaagaagaaa
aagaagaggaagaagaagaaggaggaggaggaggaggaggagggggctgagaagagcagc
tcacccttcgctgccactatgggggagaacgacgccgcgctccgggccggcggcaggggg
ctctcggacccctggacggactccgtgggggtgcgaccccgcaccaccgagcgccacatc
acggtgcacaagcggctcgtgctggccttcgccgtgtccatcgtggcgctgctcgcggtc
accatgctcgcggtgctgctcagcttgcgcttcgacgagtgcggagctagcgcagcgccg
ggcgccgacggcggccccgccggcttccccgcgcgcggcggcaacgccagccttccgggt
tcggcccggcgcaaccaccatgccggcggagactcctcgcagcccgaggtaggcggggag
gccacccctgggaccccgtcagcccagccgccgtcggaggaggagcgggagcagtggcag
ccgtggacgcagctgcgcctgtcgggccacctcaagccgctgcactacaatctgatgctc
accgccttcatggagaacttcaccttctccggggaggtcaacgtggagatcgcgtgccgg
aacgccacccgctacgtcgtgctgcacgcctcccgggtggcggtcgagaaggtgcaggtg
gccgaggaccgggtggcgggggctgttccggtggccggctttttcctctacccgcaaacc
caggtcttggtggtggtgctgaataggaccttggatgcgcagaggaattacaacctgaag
atcatctacaacgccctgatcgagaacgagctcttgggcttcttccgcagctcctacgtg
ctccacggggagagaaggttccttggtgttactcagttttcgcctacacatgccagaaag
gcatttccttgttttgatgagccaatatacaaggctactttcaaaattagcatcaagcat
caagcaacctatttatctttatccaatatgccagtggaaacttccgtgtttgaggaagat
ggatgggttacggatcacttttcacagacccctctcatgtctacatattatttagcctgg
gcaatttgcaacttcacatacaaagaaactaccaccaagagtggggttgcagtacgatta
tatgcaagacctgatgctatcagaagaggatctggggactatgctctccatataacaaag
agattaatagaattttatgaagactactttaaagtgccctattccttgccaaaactagat
cttttagctgtgcctaagcacccgtacgctgctatggagaactggggactaagtattttt
gtggaacaaagaatactgctggatcccagtgtttcatctatttcttatttactggatgtc
accatggtcattgttcatgagatatgtcaccagtggtttggtgacctcgtgactcctgtg
tggtgggaagatgtgtggctgaaggaaggttttgctcactactttgaatttgttggtacg
gactacctctaccctggctggaacatggaaaaacagaggtttctgacggatgttctgcat
gaagtgatgctgcttgacggcttggccagttcccatccagtatcacaggaagtgctacag
gcaacagatattgacagggtgtttgactggatcgcctataaaaagggtgctgctctaatt
agaatgctggctaattttatgggccattctgtatttcagaggggtttgcaagattattta
accattcataagtatggcaatgcagccagaaatgatctctggaatacactatcagaggct
ttaaaaaggaatggaaaatatgtaaatatacaagaagtaatggatcagtggacactccag
atgggttatcctgttatcaccatcttgggaaatacaacagcagaaaatagaataataatt
acccaacaacattttatttatgacatccgtgctaaaactaaagcacttgaacttcagaat
accagttacttgtggcagattccattaactattgtggtaggaaatagaagccatgtgtct
tcagaagcaattatttgggtgtctaacaaaacagagcaccacagaataactttggacaaa
ggaagctggttgctggggaacatcaatcaaactggctattttagagtcaactatgattta
aggaattggagattattaattgatcaattaatcaggaaccatgaggttctctctgtcagt
aacagagcaggtttgatcgacgatgccttcagcctagccagagctggctctttgcctcag
catatccccctggagattatcagatacctgtctgaggagaaggattttcttccttggcat
gctgccagccgagctctctatcctctagataaattactggaccgcatggagaaatacaat
gtcttcaatgaatatattttaaagcaagttgcagcaacatacatcaagcttggatggcca
aaaaacaattttaatggatctcttgttcaagcatcctaccaacatgaagagctacgtcga
gaagttataatgctggcgtgcagttttggcaacaagcactgtcatcagcaggcatcaaca
cttatttcagattggatttccagcaacaggaacagaataccactaaatgttagagacatc
gtctactgtacaggagtctcactattagatgaggatgtctgggaattcatctggatgaaa
ttccactctaccacagcagtttctgagaagaaaatattattggaagccttaacttgcagt
gatgataggaacttattaaacaggcttctgaatctatcactaaattctgaggtggtgttg
gatcaagatgcaattgatgtgataatccatgtcgctcgaaatccacatggccgagacctt
gcctggaagttttttagagacaaatggaagatattaaataccaggtatggggaggcatta
tttatgaattctaaactcattagtggagttacagaatttcttaatactgaaagtgaactc
aaagagctgaagaacttcatgaagaattacgatggagtagctgctgcctctttcttgaga
gctgtggagaccgttgaagccaatgtgcgctggaaaatgctgtatcaggatgagctcttc
cagtggttgggaaaagctctgagacactaa

DBGET integrated database retrieval system