KEGG   Panthera pardus (leopard): 109272127Help
Entry
109272127         CDS       T06062                                 

Gene name
ATP1A1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1 isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04022  cGMP-PKG signaling pathway
ppad04024  cAMP signaling pathway
ppad04260  Cardiac muscle contraction
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04911  Insulin secretion
ppad04918  Thyroid hormone synthesis
ppad04919  Thyroid hormone signaling pathway
ppad04925  Aldosterone synthesis and secretion
ppad04960  Aldosterone-regulated sodium reabsorption
ppad04961  Endocrine and other factor-regulated calcium reabsorption
ppad04964  Proximal tubule bicarbonate reclamation
ppad04970  Salivary secretion
ppad04971  Gastric acid secretion
ppad04972  Pancreatic secretion
ppad04973  Carbohydrate digestion and absorption
ppad04974  Protein digestion and absorption
ppad04976  Bile secretion
ppad04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    109272127 (ATP1A1)
   04022 cGMP-PKG signaling pathway
    109272127 (ATP1A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109272127 (ATP1A1)
   04918 Thyroid hormone synthesis
    109272127 (ATP1A1)
   04919 Thyroid hormone signaling pathway
    109272127 (ATP1A1)
   04925 Aldosterone synthesis and secretion
    109272127 (ATP1A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109272127 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    109272127 (ATP1A1)
  09154 Digestive system
   04970 Salivary secretion
    109272127 (ATP1A1)
   04971 Gastric acid secretion
    109272127 (ATP1A1)
   04972 Pancreatic secretion
    109272127 (ATP1A1)
   04976 Bile secretion
    109272127 (ATP1A1)
   04973 Carbohydrate digestion and absorption
    109272127 (ATP1A1)
   04974 Protein digestion and absorption
    109272127 (ATP1A1)
   04978 Mineral absorption
    109272127 (ATP1A1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109272127 (ATP1A1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109272127 (ATP1A1)
   04964 Proximal tubule bicarbonate reclamation
    109272127 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppad04147]
    109272127 (ATP1A1)
Enzymes [BR:ppad01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     109272127 (ATP1A1)
Exosome [BR:ppad04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109272127 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   109272127 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   109272127 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   109272127 (ATP1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 109272127
NCBI-ProteinID: XP_019313508
Ensembl: ENSPPRG00000008177
Position
Unknown
AA seq 1021 aa AA seqDB search
MGKGVGRDKYEPAAVSEHGDKKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRG
LTTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIQAATE
EEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINA
EEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNI
AFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKSSATWLALS
RIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRDRYTKIVEIPF
NSTNKYQLSIHKNPNTSEPRHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAY
LELGGLGERVLGFCHLYLPDEQFPEGFQFDTDDVNFPVENLCFVGLISMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKA
CVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTD
KLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPTHLLGLRVDWDDRWINDVEDSY
GQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETY
Y
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggggttggacgtgataaatatgaacctgcggctgtttcagagcatggcgac
aaaaagaaggccaagaaagagagggatatggatgaattgaagaaagaagtttctatggat
gaccataaacttagccttgacgaacttcaccgtaaatatggaacagacctgagccgaggc
ttaacaaccgctcgagctgctgagatcctggcccgagacggccccaacgccctcacccca
cctcccaccactcccgaatgggtcaagttctgtcggcaactgtttggcgggttctcaatg
ttgctgtggattggagcgattctttgtttcttagcttacggcatccaggccgccacagaa
gaggaacctcaaaatgataatctgtatcttggcgtggtcctctccgctgtcgtcatcata
actgggtgtttctcctactatcaagaggctaaaagttcaaagattatggaatccttcaaa
aacatggtccctcagcaagcccttgtgattcgaaacggtgagaaaatgagcatcaatgcc
gaggaggttgtagtcggggatctggtggaagtgaaaggaggagaccgaatccctgccgat
ctcagaatcatatctgccaacggctgcaaggtggacaactcctcgctcactggcgaatca
gagccccagaccaggtctccggacttcacaaatgaaaaccccctggagacgaggaacatc
gccttcttttcaaccaactgtgtggaaggcaccgcacgtggcattgtcgtgtacactggg
gatcgcacggtgatgggaagaatcgcaacactcgcgtccgggctggaaggcggccagacc
cccatcgctgccgaaattgaacattttatccacatcatcacgggtgtggctgtgttcctg
ggtgtgtccttcttcattctttctctgatccttgagtacacctggctcgaggccgtcatc
tttctcatcggtatcattgtagccaacgtgccagagggtttgctggccactgtcacggta
tgtctgaccctcactgccaaacgcatggcgaggaaaaactgcttggtgaagaacttagaa
gccgtggagaccttggggtctacgtccaccatctgctcggataaaactggaactctcacc
cagaaccggatgacagtggcccacatgtggttcgacaatcagatccacgaagccgacacg
acagagaatcagagcggtgtgtcgttcgacaagagttcagccacctggctcgctctgtcc
aggatcgcgggtctttgtaacagggcggtgtttcaggctaaccaggaaaacctgcctatc
ctcaagcgggcagttgcaggcgacgcctcggagtccgcgctcttgaaatgcattgagctg
tgctgtggctctgtgaaggagatgagagacagatacaccaaaatcgtggagatacccttc
aactccaccaacaagtaccagctgtctatccataagaaccccaacacgtctgagccccgg
cacctgctggtgatgaagggcgccccggagaggatcctggaccgctgtagctccatcctc
ctgcacggcaaggagcagcccctagacgaggagctgaaggacgcctttcagaacgcctac
ctggagctaggtggccttggagagcgtgtgctaggtttctgccacctttatctgccagac
gaacagtttcctgaaggcttccagtttgacactgatgatgtgaatttccctgtggaaaac
ctctgcttcgtggggctcatctccatgatcgatcctcctcgggctgctgttcccgatgcc
gtgggcaaatgccgaagtgctggaattaaggtgataatggtcactggagaccaccccatc
acggccaaagccattgccaagggtgtgggcatcatctcagaaggcaacgagaccgtggaa
gacattgctgcccgcctcaacatcccagtgagccaggtgaaccccagagatgccaaggcc
tgcgtggtccacggaagcgacctgaaggacatgacctccgagcagctggatgacattctg
aagtaccacacggagatcgtgtttgccaggacctctcctcagcagaagcttatcatcgtg
gaaggctgccagagacagggggctatcgtggccgtgactggcgatggtgtgaatgactct
ccagccttgaagaaggcagacatcggggttgccatggggatcgctggctctgatgtgtct
aagcaagctgccgacatgattcttctggatgacaactttgcgtccattgtgactggagtc
gaagaaggtcgtctgatctttgataacttgaagaaatccattgcctacaccctgaccagt
aacattccagagatcacccccttcctgatatttattattgcaaacattccactaccactg
gggaccgtcaccatcctctgcattgacttgggcacagacatggttcctgccatctccctg
gcttacgagcaagctgagagcgacatcatgaagagacagcccagaaaccccaagacggac
aagcttgtgaacgagcggctgatcagcatggcctacgggcagatcgggatgatccaggcg
ctgggaggcttcttcacttactttgtgatcctggctgagaacggcttcctcccgacccac
ctgctggggctccgcgtggactgggatgaccgctggatcaacgacgtagaggacagctac
gggcagcagtggacatacgaacagaggaaaatcgtggagttcacttgccacacggccttc
ttcgtcagcatcgtggtggtgcagtgggctgacctggtcatctgtaagacccggaggaac
tccgtcttccagcaggggatgaagaacaagatcttaatattcggcctctttgaagagacg
gcccttgctgccttcctttcctactgccctggaatgggcgtggctctgaggatgtacccc
ctcaaacctacctggtggttctgtgccttcccctactctcttctcatcttcgtgtacgac
gaagtccgaaaactcatcatcaggcgacgccctggcggctgggtagagaaggaaacctac
tactag

DBGET integrated database retrieval system