KEGG   Panthera pardus (leopard): 109273220
Entry
109273220         CDS       T06062                                 

Gene name
TAF2
Definition
(RefSeq) transcription initiation factor TFIID subunit 2 isoform X1
  KO
K03128  transcription initiation factor TFIID subunit 2
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    109273220 (TAF2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109273220 (TAF2)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ppad03021]
    109273220 (TAF2)
   03036 Chromosome and associated proteins [BR:ppad03036]
    109273220 (TAF2)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109273220 (TAF2)
Transcription machinery [BR:ppad03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     109273220 (TAF2)
   Coactivators
    SAGA/TFTC/STAGA complex
     109273220 (TAF2)
Chromosome and associated proteins [BR:ppad03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     109273220 (TAF2)
SSDB
Motif
Pfam: Peptidase_M1_N HEAT_2 Peptidase_M1 SR-25
Other DBs
NCBI-GeneID: 109273220
NCBI-ProteinID: XP_019315497
Ensembl: ENSPPRG00000024848
Position
Unknown
AA seq 1251 aa
MPPTGLEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANL
NRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHNESKQRNLNYFSNAYAAAVSAVDPD
AGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSC
GYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTI
PTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYP
YSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFIS
RMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGG
GKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLA
STASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRK
RNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNK
KKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVV
AQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMK
SLFTRMFCCKTCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIK
YNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNME
KLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKV
DRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSG
TSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPEAIAGNQEA
AINPSSHAQLVGFQNPEDDHLAKEASCNMSAHQQGVKRKADTPLGSPLEPGQILEKNEDS
SKVKLKIRFSNSQDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALVPQ
HSSGCDGTPPTKPQWSMELTRKGTGKEQSPLEMSMHPAATAPLSVFTKESASSKHSDHHH
HHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD
NT seq 3756 nt   +upstreamnt  +downstreamnt
atgccgccaactggtttagagcccgccagaatgaacaggaagaaaggagacaagggcttt
gaaagcccaaggccgtataaattaacccatcaggtcgtctgcatcaacaacataaacttt
cagagaaaatctgttgtgggattcgtggaactgactatatttcccacagttgcaaacttg
aatagaatcaagttgaacagcaaacagtgtagaatataccgagtaaggatcaatgattta
gaagctgcttttatttataatgacccaaccttggaagtctgtcacaatgaatcaaaacag
agaaatctaaattatttttctaatgcttatgccgctgcagttagtgctgtggatcctgat
gcaggaaatggagaactttgcattaaggttccctcagagttatggaaacatgttgatgaa
ttaaaggtcctaaagatacacatcaatttttctttggatcagccaaaaggaggtcttcat
tttgtggtacccagtgttgagggaagtatggcagagagaggtgctcatgttttctcttgt
gggtatcaaaattccacaagattttggttcccatgcgttgattcatactctgaattatgt
acatggaaattagaatttacggtagatgccgcaatggtggctgtttccaatggagatttg
gtggagacagtatatacccatgatatgaggaagaagaccttccattatatgctcaccatt
ccaacagctgcatcaaatatctctttggccattggaccttttgaaatacttgtagatcca
tatatgcacgaggttactcatttttgtttacctcagcttcttccactgcttaaacatact
acgtcatatcttcatgaagtttttgagttttatgaagaaattcttacatgtcgataccca
tactcctgttttaagacagtattcatcgatgaggcttatgttgaagtggctgcttatgct
tccatgagtatatttagcacaaatcttttacatagtgccatgattatagatgagacacct
ttgactagaaggtgtttagcccagtccttggcccagcagttttttggatgtttcatatcc
agaatgtcttggtctgatgaatgggtactgaagggaatttctggctatatttatggactt
tggatgaaaaaaacttttggtgttaatgaataccgccactggattaaagaggagctagac
aaaatagtggcgtatgaattaaaaactggtggagttttattacatcccatatttggtgga
ggaaaagagaaggataatccagcatctcatctacacttttcaataaagcatccacataca
ctttcctgggaatactacactatgtttcagtgtaaagctcaccttgtgatgagattgatt
gaaaataggatcagtatggaattcatgctacaagttttcaataaactgttaagtttggct
agtactgcttcatcgcagaagttccagtcacatatgtggagtcagatgttggtttccaca
tctgggtttttgaaatccatctcaaatgtctctggcaaagacatccagcctttaataaaa
cagtgggtagaccaaagtggagtggtaaaattttatggaagttttgcatttaataggaaa
cgaaatgtcttggaattggaaataaaacaggattatacatctcctggaactcagaaatat
gtgggaccacttaaagtgacagtgcaggaattagatggatccttcaatcatacgttgcaa
attgaagaaaacagccttaaacatgatataccctgtcattccaaaagcagaaggaataag
aagaaaaaaattccactgatgaatggagaagaagttgacatggatctttctgcgatggat
gctgattcccctttgctgtggataaggatagacccagatatgtcagtgctgaggaaagtt
gagtttgagcaagctgattttatgtggcagtatcagctccgctatgaaagagatgttgtt
gcacagcaagagtccattctggccttggaaaaattccctacgccagcatctcgtctcgct
ctcactgacatactagaacaagagcagtgtttctaccgagtgagaatgtcagcttgcttc
tgccttgcaaagattgcaaattcaatggtaagcacatggacaggaccaccagccatgaag
tcactttttaccagaatgttttgttgtaaaacttgtccaaacattgtgaaaacaaacaac
tttatgagctttcaaagctattttctacagaagactatgccagttgcaatggctttattg
agagatgttcacaacctttgtcccaaagaagtcttaacgttcattttagacttaatcaag
tacaatgacaacagaaaaaataagttttcagataattattatcgtgcagaaatgattgat
gcccttgccaactctgttacgcctgcagtcagtgtgaataatgaagttcgaactttggac
aacttaaatccagatgtgcgacttattcttgaagaaatcaccaggtttttgaatatggaa
aaacttcttccaagttatagacatactatcactgtcagttgtttgagagccataagagtg
cttcagaagaatggacatgtgccaagtgatcccgctctttttaagtcttatgccgagtat
ggacactttgtggacattaggatagcagctttggaagcagtcgttgattatactaaagtg
gaccggagttacgaagaactgcaatggctacttaatatgattcagaatgaccctgtcccc
tatgtaagacataagattctaaacatgttgactaagaacccaccatttactaagaacatg
gagtctcccttatgtaatgaagccttggtagatcaactttggaaacttatgaattctggt
acttcacatgactggaggttacgttgtggtgctgtggacttgtacttcacactttttggc
ctcagtagaccttcctgcttgcccttgccagagcttgggttggttcttaatctaaaagag
aaaaaagctgtcttgaatccgaccataattccagaggccatagcaggcaaccaagaagct
gcgattaatccaagtagtcacgcacagctagttggatttcagaaccctgaagatgatcac
cttgccaaggaagcatcatgtaatatgtcagctcatcagcagggagtgaagaggaaggct
gatacaccactggggtccccactagaacctggtcaaatactggagaagaatgaggatagc
agtaaagtcaaactcaaaatcagattttcaaattctcaagatgaggaggaaattgatatg
gacactgttcacgatagccaggcgtttatttcccatcatttgaacatgcttgaaaggcca
tcaactccagggctttctaaatatcgtccagctagctcccgatctgctttagtaccccaa
cactcatcaggctgtgatggcacacctcccacgaaaccccagtggagcatggaacttaca
cggaagggaacaggtaaagaacagtcacctttggagatgagtatgcatccagctgcaaca
gctccactctcagtgtttactaaggaatccgcgtcctccaaacacagtgaccaccatcac
caccatcaccatgaacacaagaaaaagaagaagaagcacaaacataagcataagcacaag
cacaagcatgatagtaaagagaaggacaaagagcctttcactttctccagccctgccagc
ggcaggtccattcgttctccttctctttcagactga

DBGET integrated database retrieval system