KEGG   Panthera pardus (leopard): 109275446Help
Entry
109275446         CDS       T06062                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ppad04131]
    109275446 (DOCK8)
Membrane trafficking [BR:ppad04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109275446 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N GPR15L
Motif
Other DBs
NCBI-GeneID: 109275446
NCBI-ProteinID: XP_019319203
Ensembl: ENSPPRG00000003143
Position
Unknown
AA seq 2101 aa AA seqDB search
MATLPGAERRAFALKINRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVE
PVDFEGLLMTHLNSLDVKLAQELGDFTEDDLDVAFTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNQKNQGSAEICSFKKTGSRRDFHKTLQKQTFESESLENSEPSAQARPR
HLNVLCDVSGKGPLTACGFDLRSLQPDQRLENLLQHVSAEDFEKQNEEARRTNRQAELFA
LYPAVDEEDAVEIRPVPECPKEHLGNRILVKVLTLKFEIEVEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVAPSSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGD
CAEPYMVIKESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLTSFFNVSTLDRE
VTDVESMVGRSSVGERRTLSQSRRLSERALSLEENGVGSNFKATPMTINSFFKQEGDRLS
DEDLFKFLADYKRSSSLQRRVKSIPGLLRLEISPAPEIINCCLTPEMLPVKPFPENRTRP
HKEILEFPIREVYVPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMSGEDASNAMPI
IFGKSNGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVHHHLLFTFYHISCQQKQGA
SVESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKG
VFNIEVQAVSSVHTQDNHLERFFTLCHSLESQVTFPIRVLDQKISETSLEHELKLSLICL
NSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLAKD
QHGRNCLLASYVHYVFRLPEPPRDSPKSGAPAGLPDPRYHTFGRTSAAAVSSKLLQARVM
SSSNPDLAGPHCAADEEVKNIMSSKIADRNCNRMSYYCSGNNDVPSSTTAPRPASKKHFH
EELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQYVHNMDKRDNFRRTRFSDRFKDDIT
TIVNVVTSETAALLVKPQKENEQAEKMNISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSA
KLNNLPMLISMRLEFLRILCSHEHYLNLNLFFMNADTAPASPCLSISSQNSSSCSSFQDQ
KIASMFDLTPEYRQQHFLTGLLFTELAAALDAEGEGISKVQRKAVSAVHSLLSSHDLDPR
CVKPEVKVKIAALYLPLVGIILDALPQLYDFTAADARSGKNRANGSDEEQEGAGAINQNV
ALAIAGNNFNLKTSGTMLSSLPYKQYNMLNADTTRNLMICFLWIMKNADQTLIRKWIADL
PSMQLNRILDLLFICVSCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMM
KRCRAPGNDRFPGLNENLRWRKEQTHWRQANEKQDKTKAELDQEALISGNLATEANLIIL
DMQENIIQASSALDCKDSLLGGVLRVLVNSLSCDQSTTYLTHCFATLRALIAKFGDLLFE
EEVEQCADLCQRVLHHCSSSMDVTRTQACATLYLLMRFSFGATSNFARVKMQVTMSLASL
VGKAPDFNEEYLRRSLRTILAYAEEDMAMQATLFPTQVEELLCNLNSILYDTVKMREFQE
DPEMLMDLMYRIAKSYQTSPDLRLTWLQNMAEKHMKKKCYTEAAMCLVHAAALVAEYLSM
LEDHSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEHAAEL
FSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDSIISKGHKRMFGTYFRVG
FYGSKFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSAPVDKTKLDP
NKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTV
LTTMHAFPYIKTRIGVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQ
GSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITAD
QREYQQELKKNYNKLKENLRPMIERKIPELYKPIFRIESSKRDSFHRSSFRKCETQLSQG
S
NT seq 6306 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgccgggcgcagagcggcgcgcgttcgcgctcaagatcaacaggtattct
tcggcggagatcaggaagcagtttactctccccccaaacctgggccagtaccatcgacag
agcataagtacctccggcttcccctctctccaactacctcagttttatgacccggtggag
ccggtggacttcgaagggcttctgatgacacatctgaacagcctggatgtgaagctggcc
caggagctgggagacttcaccgaggacgatttggatgtggcgttcacgccaaaggaatgt
cgcactttgcagccctctttgccggaggaaggggttgaactggaccctcacgtcagggac
tgtgttcagacctatattcgggagtggctaatcgtgaaccaaaaaaaccaaggaagtgcg
gagatttgcagctttaaaaagactggatcccgaagggattttcacaagacacttcagaaa
cagacgtttgagtcagaatccttggagaacagtgaacccagcgcgcaggcacgcccccgc
cacttaaatgtgctgtgtgacgtgtccgggaaaggtcccctcaccgcgtgtggcttcgac
ctccgcagcctgcagcctgaccagcggctggagaacctcctgcagcacgtgagtgctgag
gacttcgagaagcagaatgaggaggctcggaggaccaatcggcaggcagagctctttgcc
ttgtacccagcggtggacgaggaggatgccgtggaaatacgtccggtaccagaatgtcct
aaggaacatctgggcaacagaatactggtcaaggtcctgaccctgaagttcgagattgaa
gttgaacctctgtttgccagcatcgccctctacgatgttaaagaaaggaaaaagatctcg
gaaaattttcactgtgacctgaactctgaccagttcaaaggatttctgcgtgctcacacg
ccctctgttgccccgtcgagtcaggcgagatctgccgtgttttccgtcacctatccgtcc
tccgacatctacctagtcgtcaagattgaaaaagtccttcagcagggagagattggagac
tgcgcagaaccctacatggttatcaaagaaagcgatggcggaaagagtaaagaaaagatt
gaaaaactaaaacttcaggctgaatccttctgccagcgtttggggaaataccggatgcct
tttgcctgggctcccataagcttaacaagtttcttcaatgtctccaccctggacagggag
gtaaccgatgtggagtccatggttgggagaagttctgtgggggagcggagaactttgtcc
caatctagaaggctttctgaaagagccctctccttggaggaaaatggggtcggatccaac
ttcaaggccacccccatgaccattaacagctttttcaagcaggagggggatcgccttagt
gatgaagacttattcaagtttttggctgactacaaaagatcttcctccttacagagaaga
gtcaagtcaattccaggcttgctcagactggaaatttctccagctccagagatcatcaac
tgctgtctgactcctgaaatgctgccagtgaaaccttttcccgaaaaccggacgcgtcct
cacaaagagattttggaatttccaatccgggaagtctatgtcccccatactgtgtacaga
aaccttctctacgtctacccgcagaggctgaactttgctaataaactagcatctgcccgg
aacattacaataaagatccagtttatgtctggggaggatgctagcaatgctatgccgatc
atcttcggaaaatctaatggcccggagtttctccaggaagtttacacagccgttacatac
cataataagtctcctgacttctatgaagaagtgaaaattaagcttcctgctaagctcaca
gtacatcaccacctcctgttcaccttctatcatatcagctgtcagcagaagcaaggagcc
tccgtggaaagtcttctgggatattcgtggctgccaattctcttaaatgaacgccttcaa
acgggatcctactgtctcccagttgccttggaaaagctgccccccaactattccatgcat
tctgcagagaaagtccctctacagaaccctcccattaagtgggctgaaggacataaggga
gtatttaatattgaagtgcaagctgtttcctcggttcacacccaggacaaccacctggag
aggttcttcaccctctgccactccctggagagccaggtgaccttccccatccgcgtgctg
gaccagaagatcagcgagacgtcgctggagcacgagctgaagctcagcctcatctgcctg
aactcctcccgcttggagccgctggtgctgttcctgcacctggtgctggacaagctcttc
cagctctccgtgcagcccatggtcatcgccggccagacagccaacttctcccagtttgcc
tttgagtctgtcgtggccatcgccaacagtctgcacaacagcaaggacctggccaaggac
cagcacgggaggaactgcttgctggcctcgtacgtgcactacgtcttccgcctgccggag
cctcccagggactcgcccaagtcaggcgcccctgctggcctccccgaccctcgctaccac
acctttggacgcacgtcggctgccgccgtgagttcaaagctgctgcaggcgcgggtgatg
agcagtagtaatccagacctcgcgggaccacactgtgcagcagacgaggaggtaaagaac
atcatgtcgtcaaagattgctgatcgtaactgcaacagaatgtcttactattgctctggc
aacaatgatgttcccagttcgaccacagccccaaggccagccagcaaaaagcatttccac
gaggagcttgccctgcagatggtggtcagtaccgggatggtgagagaaaccgtcttcaag
tacgcctggttcttcttcgagcttctggtgaaaagcatggcccagtatgtacataacatg
gacaaacgcgacaattttcggaggactcgcttttccgaccgtttcaaagatgacataacg
actattgtgaacgtggtcacctcggagactgcagcccttctagtgaaacctcagaaggaa
aacgagcaggcagaaaagatgaacatcagcctggctttcttcttgtacgaccttctgtcg
ctcatggatcgtggcttcgtatttaacctcatcaaacactattgcaaccagctgtcggcc
aagctcaacaaccttccgatgctcatttccatgaggctggagtttctgagaatcctctgc
agccacgagcattacctcaatctgaacctcttctttatgaatgccgatactgcgccagcg
tccccctgcctctccatctcttcccagaactcaagctcctgctccagtttccaggaccag
aagattgccagcatgtttgatctgactcccgagtaccgccagcagcatttcctcaccgga
cttctctttactgaactggctgccgccctcgatgctgagggggaagggatcagcaaagtg
caaaggaaagcggtcagcgccgtccacagcctcctgagctctcacgacctggacccgcgc
tgcgtcaaaccagaggtgaaggtcaaaattgctgccctttacctgcctctggttggcatc
attttggatgctttgccgcaactctatgactttacagctgcagatgcccgtagtggaaaa
aatcgtgccaatggctcagacgaagaacaagaaggagccggtgcaattaaccagaatgtg
gcgctggccatagctggaaataattttaatctgaagacaagtggaacaatgctttcttcc
ctgccctacaaacaatacaacatgctgaatgccgacacgacccggaacctcatgatctgc
ttcctgtggatcatgaaaaacgccgaccagaccctcatccggaagtggatcgccgacctg
ccgtccatgcaactgaacaggattttagatctccttttcatctgtgtctcgtgtttcgag
tacaagggaaaacagagttctgacaaagtcagcacccaagtcctgcagaagtcaagggat
gtcaaggccaggctggaagaggctttgctccgcggggaaggggccaggggggagatgatg
aaacgctgccgggctccagggaatgaccgatttccaggcctaaatgaaaatttgagatgg
aggaaggagcagacacattggcggcaagctaatgagaagcaagataaaacaaaggcagag
ttagatcaagaagccttgatcagtggcaatctggctacagaagcaaatttaatcatcctg
gatatgcaggaaaacattatccaggcaagctcggctctggactgtaaagacagcctgctg
ggaggtgtcctaagggtcctggtgaattctctgagctgtgatcagagcaccacctacctg
actcactgctttgcaacactccgggctctcatcgccaagttcggggacctgctgtttgag
gaggaggtggaacagtgtgcagacctgtgtcagcgagtgctacatcactgtagcagcagc
atggacgtcacgcggacccaagcctgtgccaccctctacctcctcatgagattcagcttt
ggagccaccagcaactttgccagagtaaagatgcaagtaaccatgtctctggcatctttg
gtgggcaaagcaccagacttcaatgaggagtacctgagaagatccttgaggacgatcttg
gcctatgcagaagaggacatggccatgcaggccactcttttccccacccaggtggaggaa
cttctctgcaatctgaacagcatcttatacgacacggtgaaaatgagggaatttcaggaa
gatcctgagatgcttatggatctcatgtacagaattgccaaaagttaccagacatctcct
gatctgcggctgacctggctccagaacatggcagagaaacacatgaagaagaagtgctac
acggaggccgccatgtgcctggtgcacgcggccgccttggtggccgagtatctgagcatg
ctggaggaccacagctacctgcccgtgggcagcgtcagctttcagaatatttcttccaac
gtgctggaggagtctgcggtctctgatgacaccttgtcccctgacgaggacggtgtgtgc
tcgggccggtacttcaccgagagcggcctggtgggcctcctggagcatgcggctgagctg
ttcagcacgggaggactgtacgagacagttaacgaggtctacaagctggtcattcccatc
ctggaagcacatagagacttccggaagctgacctccacacacgacaagctacagaaggct
tttgacagcatcattagcaagggtcataagagaatgtttggaacctacttccgagttggt
ttctatggatccaaatttggggatttagatgagcaggaattcgtttacaaagagcctgca
attaccaagctacctgagatttctcacagactagagggattttatggtcagtgttttggt
gcagaatttgtggaagtgataaaagactctgctccagtggacaaaaccaagttggatcct
aacaaggcctacatacaaatcacttttgtggagccctactttgatgagtatgagatgaaa
gacagggtcacctactttgagaagaatttcaatctgcgaaggttcatgtacaccacgccc
ttcaccctggaggggcggcctcggggagagctccacgagcaataccggaggaacaccgtc
ctgaccaccatgcacgccttcccctacatcaagaccaggatcggcgtcatccagaaggaa
gagttcgttttgacgccaattgaagtcgccattgaagacatgaagaagaagaccctccag
ttagcggttgccattaaccaggagccccccgatgccaagatgctccagatggtgctgcag
ggctctgtcggagctactgtgaaccagggaccgttggaagtagcccaagtgttcttggcc
gaaattccagctgacccaaagctctatcgacatcacaacaagctgaggttatgctttaag
gaattcataatgcgatgcggtgaggccgtggagaaaaacaaacgtctcatcacggcggac
cagagggaatatcagcaggaactcaaaaagaactacaacaagctgaaagagaacctcagg
ccaatgatcgagcggaaaattccagaactctacaagccgatattcagaattgagagttcc
aagagagactccttccacagatctagtttcaggaaatgtgaaacccagttgtcacagggc
agttaa

DBGET integrated database retrieval system