KEGG   Panthera pardus (leopard): 109277061Help
Entry
109277061         CDS       T06062                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad04010  MAPK signaling pathway
ppad04260  Cardiac muscle contraction
ppad04261  Adrenergic signaling in cardiomyocytes
ppad04921  Oxytocin signaling pathway
ppad05410  Hypertrophic cardiomyopathy (HCM)
ppad05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
ppad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109277061 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109277061 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109277061 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    109277061 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    109277061 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    109277061 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    109277061 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ppad04040]
    109277061 (CACNG5)
Ion channels [BR:ppad04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109277061 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 DUF716 DHHC
Motif
Other DBs
NCBI-GeneID: 109277061
NCBI-ProteinID: XP_019322002
Ensembl: ENSPPRG00000024630
Position
Unknown
AA seq 275 aa AA seqDB search
MSGCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVVLPQNQSMEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTRDTETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgcgggaggaaggccctgaccctgctgagcagcgtctttgctgtctgtggc
ctgggtctcctgggcattgcggtcagcactgactactggctgtacctggaggagggcgtg
gtcctgccccagaaccagagcatggagatcaagatgtccctgcactccggcctctggcgt
gtctgcttcctcgcaggtgaggagcggggccgctgcttcaccatagagtatgtgatgccc
atgaacacccagctgacatcagagtccaccgtcaatgttttaaaaatgattcgttcggcc
acaccattccctctggtcagcctcttcttcatgttcattgggtttatcctgagcaacatc
ggacacatccgtccccataggactatactggcctttgtctccggcatcttttttattctc
tcaggcctctctctggtggtgggcctggtgctgtacatctccagcatcaacgatgagatg
ctcaacaggaccagggacacggagacctatttcaactacaagtatgggtggtcgtttgcc
tttgctgccatctctttccttttgacagagagcgctggggtgatgtccgtgtacctgttc
atgaagaggtacaccgccgaggacatgtacaggcctcaccccggcttctaccgtccccgt
ctgagcaactgctccgattactcaggccagttcctgcacccggacgcctgggtccggggc
cgcagcccgtctgacatctccagtgacgcctccctgcagatgaacagcaactacccagcc
ttgctcaagtgccccgactatgaccagatgtcatcctctccctgctga

DBGET integrated database retrieval system