KEGG   Panthera pardus (leopard): 109278016
Entry
109278016         CDS       T06062                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00230  Purine metabolism
ppad00240  Pyrimidine metabolism
ppad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109278016 (DCK)
   00240 Pyrimidine metabolism
    109278016 (DCK)
Enzymes [BR:ppad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109278016 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 CoaE
Other DBs
NCBI-GeneID: 109278016
NCBI-ProteinID: XP_019323539
Ensembl: ENSPPRG00000001003
UniProt: A0A6P4XXZ0
Position
Unknown
AA seq 269 aa
MHSGHHQTRMATPPKRSCPSPATGFEGVRIKKIAIEGNIASGKTTFVNILKQVCEDWEVV
PEPVARWCNVQSAQDDCEELTPSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAC
LNGKLKDAEKPVLFFERSIYSDRYVFASNLYESDCMNETEWTIYQDWHDWMNHQFGQSLE
LDGIIYLRATPEKCLNRIYLRGRNEEQGIPLEYLEKLHEKHESWLLHRTLKTDFDFLQEI
PILTLDINEDFKDKHDSLVEKVKEFLSTL
NT seq 810 nt   +upstreamnt  +downstreamnt
atgcactcgggccaccaccagactagaatggccaccccacctaagaggagctgcccgtct
cccgcgaccggctttgagggggtccgcatcaagaagattgccatcgaagggaacattgct
tcagggaagacaacatttgtgaatatccttaaacaggtctgtgaggattgggaagtggtt
cctgaacctgttgccagatggtgcaatgttcaaagtgcacaagatgactgtgaggaactg
acaccgtctcagaaaagtggtgggaatgttcttcaaatgatgtatgagaaacctgaacga
tggtcttttaccttccagtcatatgcctgcctcagtcgaatacgagcccagcttgcctgt
ctcaatggcaagctcaaagatgcagagaaacctgtattattttttgaacgatctatatat
agtgataggtatgtttttgcatctaatttgtatgaatctgactgcatgaatgaaacagag
tggacaatttatcaagactggcatgactggatgaatcaccagtttggtcaaagccttgaa
ctggatggaatcatttatcttcgagccacaccagagaaatgcttgaatagaatatattta
cggggaagaaatgaagaacaaggcattcctcttgagtatttagagaagcttcacgaaaag
catgagagctggctcctgcatagaaccctgaaaaccgactttgattttctacaagaaatc
cccatcttaacactggatattaatgaagactttaaagacaaacacgacagtctagttgaa
aaggtcaaagaatttttgagcactttgtga

DBGET integrated database retrieval system