KEGG   Panthera pardus (leopard): 109278915
Entry
109278915         CDS       T06062                                 

Gene name
LVRN
Definition
(RefSeq) aminopeptidase Q
  KO
K13724  aminopeptidase Q [EC:3.4.11.-]
Organism
ppad  Panthera pardus (leopard)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppad01002]
    109278915 (LVRN)
Enzymes [BR:ppad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109278915 (LVRN)
Peptidases and inhibitors [BR:ppad01002]
 Metallo peptidases
  Family M1
   109278915 (LVRN)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N zf-C2H2_assoc3
Other DBs
NCBI-GeneID: 109278915
NCBI-ProteinID: XP_019325152
Ensembl: ENSPPRG00000009237
Position
Unknown
AA seq 992 aa
MGPLSSSGFYVSRAVALLLAALAAALLLALAVLAALYGRCARVQPSDLHHSGVPDAASSP
RGTQEEQLPTWPPRPTREPAGTATPGHWRPPGPWDQLRLPPWLVPLHYELELWPRLRPNE
FQSPTLSFTGRVNITVRCTAATARLLLHSLFLDCESAEVRGPLFSGARDGAVGRVPVDDV
WFAFDMQYMVLELGATLQPGSRYELQLSFSGLVYRDLREGLFFSIYTDQGERRALLASQM
EPTFARSVFPCFDEPALKATFNITIIHHPSYGALSNMPKLGQSEKRDVNGSVWTVTTFST
TPHMPTYLVALAICDYDHVSRTERGQEIRIWARKDAIANGNAAFALNITGPIFSFLEDLF
NISYPLPKTDIIALPTFDNSAMENWGLLIFDESLLLMQPNDQVTDKKAVISFILSHEIGH
QWFGNLVTMNWWNDIWLKEGFASYFEFGVINYFNPKFRRNEVFFSNILHHVLSEDHALVS
RAVSLKVENFTETSEINELFDLFTYNKGASLARMLSSFLNENVFISALKSYLKTFSYSNA
EQDDLWRHFQMVVDDQSKILLPAPVKSIMDRWTHQSGFPVITLNVSTGAMKQEPFYLGKV
KNQTLLTHNDTWIVPILWIKNGITQSLVWLDKSSKIFPEMQVSDSDHDWVILNLNMTGYY
RVNYDNVGWKKLKQQLEKDPKAIPVIHRLQMIDDAFSLSKNNYVEIETALDLTKYLAEED
EIIVWYAVLVNLVTKDLVFDVNNYDMYPLLKKYLLKRLISIWNMYSTVIRENVAALQDDY
LALVALEKLFETACWLGLEDCLQLSRELFKHWTNHPGNEIPYPIKSVVLCYGVAFGSDEE
WDFLLNMYSNKTKEEERIQLTYAMSCSKDPWILHRYLEYAVTAAPFTFNETNIMEVVAES
EVGRYIVKDFLINNWQAVSERYGTQSLVNLMYIIGRTISTDLQITELQQFFGNMLEEHQK
LTVRAKLQTIKNKNVENKKRNARMTAWLRKNT
NT seq 2979 nt   +upstreamnt  +downstreamnt
atggggcccctttccagctctggcttctacgtgagccgcgcggtagccctgctgctggcc
gcgctggccgccgcgctcctgctggcgctggcggtgctcgccgccctgtacggccgctgc
gcgcgcgtccagccgtccgacctccatcacagcggggtcccggacgccgcgtcctcgccg
cgcggcacgcaggaggagcagctgcccacctggccgccccgccccactcgtgaaccggcg
ggtacggccaccccgggccactggcgacccccgggcccctgggaccagctgcgcctgccg
ccctggctcgtgccgctgcactatgagctggagctgtggccccggctgcgtccgaacgag
ttccagtctccgacgttgagcttcaccggccgcgtgaacatcaccgtgcgctgcaccgcg
gccaccgcgcggctgctgctgcacagcctcttcctggactgcgagagcgccgaggtgcgg
ggtcctctgttctctggcgcccgagacggcgcggtgggtcgcgtgcccgtggacgacgtg
tggttcgctttcgacatgcagtatatggtcctggagctcggcgcgaccctgcagcccggg
agccggtatgagctgcagctcagtttctcgggcctggtgtaccgggacctcagggagggg
ctcttcttcagcatctacacggaccagggcgagcgcagggccctgttagcatctcagatg
gagccaacatttgccaggagcgtttttccttgttttgatgagccagctctaaaggcaacc
tttaatattacaattattcatcatccaagctatggggccctttccaatatgccaaagcta
ggtcagtctgaaaaaagagacgtgaatggaagcgtgtggactgttaccaccttttccacc
actccccacatgccaacttatttagtcgcgttggccatatgtgactatgaccacgtcagc
agaactgaaaggggccaagagatacgcatctgggcccggaaagatgccatcgcaaatgga
aacgcagcctttgctttgaacatcacaggtcctatcttctcttttctggaagatttgttt
aatattagttaccctcttcctaaaacagatataattgccttgcctacttttgacaacagt
gcaatggaaaactggggactattgatattcgatgagtcattattgttgatgcaaccaaat
gatcaagtaacagacaaaaaggctgtgatctccttcattctctcccacgagattggacat
cagtggtttggaaatctggttaccatgaattggtggaatgatatctggctcaaagaaggt
tttgcatcttattttgaatttggagtcattaactacttcaatcctaaattccgaagaaat
gaagtctttttttctaacattttacatcatgtcctcagtgaagatcacgccctggtgtct
agagctgtgtccttgaaggtggaaaatttcacagaaaccagtgaaataaatgaactcttt
gacttatttacttacaacaagggagcatctttggcccgaatgctttctagctttctgaat
gagaatgtatttatcagtgcactcaagtcatatttgaagacattttcttactcaaatgct
gagcaagatgatttatggaggcattttcaaatggtcgtagacgaccagagtaaaattctt
ttgccagcgccagtaaaaagcataatggaccgttggacacaccagagtggttttccagtc
atcaccttaaatgtatctactggtgccatgaaacaggaaccattttatcttggaaaggtt
aaaaatcagactctcctaacccacaacgacacatggattgtacctattctctggataaaa
aatggaatcacacagtctctagtttggctagataaaagcagcaaaatattccctgaaatg
caagtttcagattctgatcacgactgggtgattctaaatttgaatatgactggatattac
agagttaactatgataacgtaggttggaaaaagctaaaacaacagcttgaaaaagatcct
aaggccatccctgttattcacagactgcagatgatcgatgatgccttttccttgtcgaaa
aacaattatgttgagattgaaacagcccttgatttaaccaagtaccttgctgaagaagat
gaaatcatagtatggtatgcagtcttggtgaacctggtaaccaaggatcttgtttttgat
gtgaacaactatgatatgtacccattattaaagaagtatctgttaaagagacttatctca
atatggaatatgtattcaactgtaattcgtgaaaacgtggcagcattacaagatgactat
ttagccctcgtggccctggaaaaactttttgaaactgcgtgttggttgggactggaagac
tgtcttcagctgtcaagagaactcttcaaacactggacaaaccatccagggaatgaaata
ccttatccgattaaaagtgtagttttatgttatggcgttgccttcggaagtgatgaagaa
tgggactttttgttaaatatgtactctaataaaacaaaggaagaagaaaggattcaactc
acttatgcgatgagctgcagtaaagacccatggatacttcacagatatctggagtatgcc
gtcacggcagctccattcacttttaacgaaacaaatataatggaagttgtggcggaatcc
gaagtaggccggtacattgtgaaggactttttaatcaacaattggcaagctgtgagtgaa
aggtatggaacacaatcgctggttaatctaatgtacataatagggagaaccataagcaca
gatttacagatcacagagctgcagcagtttttcggcaacatgttggaagagcaccagaag
ctcacagttcgtgccaaattacagacaataaagaacaaaaatgtggaaaacaaaaagcgc
aatgccaggatgacagcgtggctacggaaaaacacgtaa

DBGET integrated database retrieval system