KEGG   Panthera pardus (leopard): 109279168Help
Entry
109279168         CDS       T06062                                 

Gene name
CAT
Definition
(RefSeq) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
ppad  Panthera pardus (leopard)
Pathway
ppad00380  Tryptophan metabolism
ppad00630  Glyoxylate and dicarboxylate metabolism
ppad01100  Metabolic pathways
ppad01200  Carbon metabolism
ppad04068  FoxO signaling pathway
ppad04146  Peroxisome
ppad04211  Longevity regulating pathway
ppad04213  Longevity regulating pathway - multiple species
ppad05014  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:ppad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109279168 (CAT)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    109279168 (CAT)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109279168 (CAT)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109279168 (CAT)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    109279168 (CAT)
   04213 Longevity regulating pathway - multiple species
    109279168 (CAT)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    109279168 (CAT)
Enzymes [BR:ppad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     109279168 (CAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Catalase Catalase-rel Secretogranin_V
Motif
Other DBs
NCBI-GeneID: 109279168
NCBI-ProteinID: XP_019325614
Position
Unknown
AA seq 527 aa AA seqDB search
MADSRDPASDQMKLWKEQRASQKPDVLTTGAGNPIGDKLNVITAGPRGPLLVQDVVFTDE
MAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYCKAKVFEHIGKRTPIAVRFSTVAGES
GSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDAILFPSFIHSQKRNPQTHLKDPD
MVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEVVYCKFHYKTDQ
GIKNLSVEDAARLSQEDPDYGLRDLFNAIATGNYPSWTFYIQVMTFSEAETFPFNPFDVT
KVWPHNDYPLIPVGKLVLNRNPVNYFAEVEQMAFDPSNMPPGIEPSPDKMLQGRLFAYPD
THRHRLGPNYLQIPVNCPFRARVANYQRDGPMCMVDNQGGAPNYYPNSFSAPQEQRCAIE
HSSRCSPDVQRFNSANEDNVTQVRTFYMKVLNEEERKRLCENIAGHLKDAQLFIQKKAVK
NFSDVHSDYGARIQALLDKYNAEKPKKAIHTWMQHGSHLAAREKANL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagccgggatccagccagcgaccagatgaagctctggaaggagcagcgggcc
tcgcagaaacctgacgtcctgaccaccggggccggtaatccaatcggagacaaacttaat
gttattacagcagggccccgaggacctcttcttgttcaggatgtggttttcactgatgaa
atggctcactttgaccgggaaagaattcctgagagagtggtgcatgctaaaggcgcagga
gcttttggctacttcgaggtcactcatgacattaccaaatactgcaaagcaaaggtgttt
gagcatattggaaagaggactcccattgcggttcgattctccactgtcgctggagagtcg
ggctcagctgacacagttcgggaccctcgtgggtttgcagtgaaattttacacagaggat
ggtaattgggatcttgttggaaataacactcccatttttttcatcagggatgccatactg
tttccgtcctttatccacagtcaaaagagaaaccctcaaacgcacctgaaggatccggac
atggtctgggacttctggagcctgcgccctgagtctctgcatcaggtttctttcttgttc
agtgatcgagggattccagatggacacaggcacatgaatggatatggatcgcatactttc
aagctggttaatgcgaatggagaggtagtttattgcaaattccattataagactgaccag
ggcatcaaaaacctttctgttgaagacgcagcacgactttcccaggaagatcctgactat
ggcctccgggaccttttcaatgccatcgccacaggcaactacccctcctggactttttac
atccaggtcatgacgttcagtgaggcagaaacctttccatttaatccatttgatgtcacc
aaggtttggcctcacaacgactaccctcttatcccagttggtaaactggttttaaaccgg
aatccagtgaattactttgctgaggttgaacagatggcatttgacccgagcaacatgcca
cctggcatcgagcccagccctgacaaaatgcttcagggccgcctttttgcctatcctgac
acccaccgccaccgcctgggacccaactatcttcagatacctgtgaactgtcctttccgt
gctcgagtggccaactaccagcgtgacggccccatgtgcatggtcgacaatcagggtggt
gctccaaattattaccccaatagctttagtgccccccaagaacagcgctgtgccatcgaa
catagcagccggtgttctccggatgtgcagcgcttcaacagtgccaatgaagacaatgtc
actcaggtgcggaccttctatatgaaggtactgaatgaagaggagaggaaacgcctgtgt
gagaacattgctggccatctgaaagatgcacagcttttcatccagaagaaagcggtcaag
aacttcagtgatgtccattctgactatggggcccgcatccaggctcttttggacaaatac
aatgctgagaaacctaagaaagccattcacacctggatgcagcatgggtctcacttggct
gccagggagaaagcgaatctgtga

DBGET integrated database retrieval system