KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_00135Help
Entry
A8F97_00135       CDS       T04513                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A8F97_00135
Enzymes [BR:ppar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     A8F97_00135
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     A8F97_00135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: AOR57323
UniProt: A0A0H3I7F5
Position
33210..34190
Genome map
AA seq 326 aa AA seqDB search
MSKIIAVTMGDPAGIGPEIIIKSLAEGELSGASAVVVGCVQTMRRVLALNVVPAVELKII
DKPADAVFAPGVINIIDEPLEDPQALKPGVVQAQAGDLAYRCIKKATELAMAGEVHAIAT
APLNKEALHSAGHLYPGHTELLAKLTNSRDYAMVLYTDKLKVIHVSTHIALRKFLDTLNR
DRVETVIDMADVFLKRVGFTHPRIAVAGVNPHAGENGLFGDEEIKIVSPSVEAMKAKGID
VYGPCPPDTVYLQAYEGQYDMVVAMYHDQGHIPLKLLGFYDGVNITAGLPFIRTSADHGT
AFDIAWTGKAKPESMAISIQLAMQLA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaattattgcagtaacgatgggtgatccggcagggattggaccagaaattatt
atcaaatctctggccgaaggtgagctttccggcgcatctgctgtggtggtgggctgcgta
cagacgatgcgacgtgttctggcgctgaatgtggtgcctgccgtagagttgaaaatcatt
gataaaccggctgacgccgtattcgcaccgggcgtcatcaacatcattgatgaaccgctg
gaagatccacaggcgctgaagccgggtgtcgttcaggcacaagcgggcgatttagcttac
cgctgcatcaagaaggccaccgaactggcaatggcgggtgaggtgcatgcgatcgcgacc
gcgccgctgaataaagaagcgctgcactcggcgggccacctttatccgggtcacaccgaa
ctgctggcgaagctgaccaacagccgcgactatgcgatggtgctgtataccgataagctg
aaggttatccatgtttcaacgcacattgcgctgcgaaaattcctcgataccctgaaccgc
gatcgcgtggaaacggtgatcgacatggcagacgtcttccttaaacgcgtcggttttacc
cacccacgtatcgccgttgccggggttaacccgcatgcgggtgagaatggcttgtttggt
gacgaagagattaaaattgtctcgccatcggttgaagccatgaaggccaaaggcattgat
gtgtatggtccgtgcccgccggataccgtctatttgcaggcgtatgaaggccagtacgat
atggtggtggcgatgtatcacgatcaggggcacatcccgctcaagctgttgggcttctat
gacggagtgaacatcaccgctgggttgccgtttattcgcacctcggctgaccacggtacg
gcatttgacattgcctggacgggtaaagcgaagcctgaaagcatggcgatctcgattcag
ctcgcgatgcaactggcctga

DBGET integrated database retrieval system