KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_02795Help
Entry
A8F97_02795       CDS       T04513                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00071  Fatty acid degradation
ppar00280  Valine, leucine and isoleucine degradation
ppar00310  Lysine degradation
ppar00362  Benzoate degradation
ppar00380  Tryptophan metabolism
ppar00620  Pyruvate metabolism
ppar00630  Glyoxylate and dicarboxylate metabolism
ppar00640  Propanoate metabolism
ppar00650  Butanoate metabolism
ppar00900  Terpenoid backbone biosynthesis
ppar01100  Metabolic pathways
ppar01110  Biosynthesis of secondary metabolites
ppar01120  Microbial metabolism in diverse environments
ppar01130  Biosynthesis of antibiotics
ppar01200  Carbon metabolism
ppar01212  Fatty acid metabolism
ppar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A8F97_02795
   00630 Glyoxylate and dicarboxylate metabolism
    A8F97_02795
   00640 Propanoate metabolism
    A8F97_02795
   00650 Butanoate metabolism
    A8F97_02795
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A8F97_02795
   00072 Synthesis and degradation of ketone bodies
    A8F97_02795
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A8F97_02795
   00310 Lysine degradation
    A8F97_02795
   00380 Tryptophan metabolism
    A8F97_02795
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A8F97_02795
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A8F97_02795
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A8F97_02795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppar04147]
    A8F97_02795
Enzymes [BR:ppar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A8F97_02795
Exosome [BR:ppar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A8F97_02795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOR57841
Position
complement(662602..663780)
Genome map
AA seq 392 aa AA seqDB search
MNDSIVIVNAKRTAIGKFAGSLANTSAIEMASATIRDCLSTLPDTLAIDEVILGNVLQAG
LGQNPAHQASQAAGLSFETPSLTISKVCGSGLKAVVLGAQSILSGDNQVCVTGGMENMSA
APYLLEKARHGYRMGDGKLVDIMIKDGLWCAFNDYHMGTTAENIAERYQLTREEQDRVAL
ASQQKAVAAIEAGRFKVEITPLSLRSKKETRIFDRDEFPRADTTLASLTALRPAFSANGT
VTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKAL
IKAGLTIGDIDLIEANEAFAAQFLAVQRDLQLDPEKVNVNGGAIALGHPIGASGARILVT
LVHALHSYNKTLGLATLCIGGGQGIAMIVERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccattgttattgttaatgccaagcgcaccgcaattggtaaatttgcaggc
agtctggccaacacctctgctatcgagatggcctctgccaccatccgcgactgcctgtcg
acgctgccggatacgctggcgatcgatgaagtgattctcggcaacgtgctgcaagccggt
ctgggacaaaaccccgcgcatcaggccagccaagctgccggtctgtcttttgaaactcct
tcactgaccatcagcaaagtatgtggctccggcctgaaggccgttgtgctgggcgcacag
tctattctgtccggcgataatcaggtctgcgtgaccggcgggatggaaaacatgagcgcc
gcgccttacctgctggaaaaagcgcgccacggttaccgcatgggagacggcaagctcgtt
gacatcatgattaaagatggtctgtggtgtgcgtttaacgattaccacatgggcaccaca
gcggaaaatatcgccgagcgctatcagctcacgcgagaagaacaggatcgggtggcgctg
gcgtcgcagcagaaagcggtcgccgcgattgaagcgggtcgcttcaaagtcgaaattacc
ccactgtcgctgcgtagcaaaaaagagacacggattttcgatcgggacgaattccctcgc
gcagacaccacgctggcgtcgttgacagcgttacgtccggcattctccgcgaatggcacc
gtcaccgctggcaacgcatccggcattaacgatgccgccgcgacgctggtgttaatgcgt
gaatccgaagcgaaaaaacagggtattaccccgctggcgcgtatccgtagctgggcttcg
gctggcgtaccgagtgaagtcatggggctggggccaattccggcgacgcagaaagcgctg
atcaaggctgggttgacgatcggcgatattgacctgatcgaagccaatgaagcctttgcc
gcgcagtttctagccgtacagcgcgatctccaactagacccagaaaaggtgaatgttaac
ggcggtgcgattgcattgggtcaccctatcggcgcgagcggtgcccgtattctcgttacg
ctggtacatgcgctgcacagctataacaaaacgctggggttggcgacgctgtgcatcggc
ggcgggcaaggtatcgccatgatcgtcgagcgcgtttaa

DBGET integrated database retrieval system