KEGG   Pectobacterium parmentieri RNS08.42.1A: A8F97_03190Help
Entry
A8F97_03190       CDS       T04513                                 

Definition
(GenBank) succinate--CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ppar  Pectobacterium parmentieri RNS08.42.1A
Pathway
ppar00020  Citrate cycle (TCA cycle)
ppar00640  Propanoate metabolism
ppar00660  C5-Branched dibasic acid metabolism
ppar01100  Metabolic pathways
ppar01110  Biosynthesis of secondary metabolites
ppar01120  Microbial metabolism in diverse environments
ppar01130  Biosynthesis of antibiotics
ppar01200  Carbon metabolism
Module
ppar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8F97_03190
   00640 Propanoate metabolism
    A8F97_03190
   00660 C5-Branched dibasic acid metabolism
    A8F97_03190
Enzymes [BR:ppar01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A8F97_03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AOR57913
UniProt: A0A0H3I568
Position
740505..741671
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPTGYACTTPREAEEAASKIGSGPWVVKCQVHAGGRGKAGGV
KVVSNKEDIRAFAENWLGKKLVTYQTDAQGQPVHQILVEAATDIDKELYLGAVVDRGTRR
VVFMASTEGGVEIEKVAEETPELIHKAAIDPLVGPQPYQGRELAFKLGLSGKQVAQFTKI
FMGLATLFLERDLALVEINPLVITKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDS
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGSPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVSVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTGAAQQVVAAVGDK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggcaaaacaactctttgctcgatatggtttaccggcaccc
accggctatgcctgtacgacaccgcgtgaagcagaagaagccgcatctaagattggctcg
ggtccgtgggttgtaaaatgtcaggttcacgcaggcggtcgcggtaaagcgggcggcgtt
aaagtagtcagtaacaaagaagacattcgcgcttttgctgaaaactggctgggtaaaaag
ctcgttacttatcaaactgacgcacagggtcaaccggttcatcagattctggttgaagcc
gcaacggatatcgacaaagagctttatctgggcgcggttgttgaccgtggcacgcgtcgt
gtcgtgttcatggcgtccaccgaaggtggcgtagaaattgaaaaagtggcggaagagacg
ccggaactgatccacaaagctgctatcgatccactggtaggtccacagccttatcagggc
cgcgagttggccttcaaactgggtttgagcggtaagcaagttgcgcaattcaccaaaatc
ttcatgggtctggcgacgctgttccttgagcgcgatctggcgctggtcgaaatcaaccca
ctggttatcaccaagcagggcgatctgatctgtctggatggcaagctgggcgcagacggt
aatgcactgttccgtcagcctgagctgcgtgaaatgcgtgacccaagccaggaagactct
cgtgaagcgcatgcagcccagtgggaactgaactatgttgcgctggacggcaacatcggc
tgtatggtgaacggtgccggtctggcgatgggcaccatggacatcgtgaagctacacggc
ggttctcctgctaacttccttgatgtaggcggtggcgcaacgaaagaacgtgttactgaa
gcgttcaaaattatcctgtctgacgacaaggtaaaagccgtctttgttaacatctttggt
ggcatcgtgcgttgcgatttgatcgctgacggtatcatcggcgcggtagccgaagtgggc
gttagcgtgccggttgtggtacgtcttgaaggaaacaatgcggaactgggtgccaagaaa
ctggcggatagcggcctgaatattattgccgcgaccagcctgacgggtgcagctcagcag
gttgttgcagcagtgggggataaataa

DBGET integrated database retrieval system